:. Patents


Monocotyledon Plant Cells and Plants which Synthesize Modified Starch
Source: United States Patent and Trademark Office (USPTO)
28/10/2009

  • Patent Number:
  • 7,608,708

  • Inventors:
  • Schewe; Gabi (Hamburg, DE), Knies; Petra (Hamburg, DE), Amati; Simone Franceska (Hamburg, DE), Lorz; Horst (Hamburg, DE), Becker; Dirk (Hamburg, DE), Landschutze; Volker (Berlin, DE), Pilling; Jens (Koln, DE)

  • Applicant:
  • Bayer CropScience AG (Frankfurt, DE)

  • Publication Date: 
  • 27/10/2009

  • Application Number:
  • 11/585,179

  • Filed:
  • 24/10/2006



    The present invention relates to monocotyledon plant cells and plants which are genetically modified, wherein the genetic modification consists of the introduction of an extraneous nucleic acid molecule which codes for a protein with the biological activity of an R1 protein. The present invention further relates to means and methods for the production thereof. Plant cells and plants of this type synthesise a modified starch, which is characterised in that it has an increased phosphate content and/or a modified phosphorylation pattern and/or an increased final viscosity in an RVA profile and/or a reduced peak temperature in DSC analysis and/or an increased gel strength in the texture analysis compared with starch from corresponding non-genetically modified monocotyledon plants. Therefore, the present invention also relates to the starch which is synthesised from the plant cells and plants according to the invention, and to methods of producing said starch. The present invention further relates to wheat flours which contain said modified starches, and to food products and bakery products which contain said wheat flours and/or starch.

    Inventors:  Schewe; Gabi (Hamburg, DE), Knies; Petra (Hamburg, DE), Amati; Simone Franceska (Hamburg, DE), Lorz; Horst (Hamburg, DE), Becker; Dirk (Hamburg, DE), Landschutze; Volker (Berlin, DE), Pilling; Jens (Koln, DE) 
    Assignee: Bayer CropScience AG (Frankfurt, DE)
     
    Appl. No.:  11/585,179
    Filed:  October 24, 2006

    --------------------------------------------------------------------------------

    Related U.S. Patent Documents

    --------------------------------------------------------------------------------
         
     Application Number Filing Date Patent Number Issue Date
     10794865 Mar., 2004 7217816 
     10038224 Oct., 2001 6734340 
     

    --------------------------------------------------------------------------------

    Foreign Application Priority Data

    --------------------------------------------------------------------------------
        
    Oct 23, 2000 [DE]   100 52 492
    Dec 22, 2000 [DE]   100 64 805
     

    Current U.S. Class: 536/102 ; 536/105; 536/45
    Current International Class:  C08B 31/00 (20060101); C08B 33/00 (20060101); C08B 35/00 (20060101)

     

    --------------------------------------------------------------------------------

    References Cited [Referenced By]

    --------------------------------------------------------------------------------

    Foreign Patent Documents
         
     WO 97/11188  Mar., 1997  WO
     


    Other References
    Jane et al, "Phosphorus in Rice and Other Starches", Cereal Foods World, Nov.-Dec. 1996, vol. 41, No. 11, pp. 827-832. cited by other .
    Lim et al, "Characterization of Phosphorus in Starch by .sup.31p-Nuclear Magnetic Resonance Spectroscopy", Cereal Chemistry, vol. 71, No. 5, 1994, pp. 489-493. cited by other .
    Lorberth et al, "Inhibitation of a Starch-granule-bound protein leads to modified starch and repression of cold sweetening", Nature Biotechnology, vol. 16, May 1998, pp. 473-477, also referred to as XP 002111459. cited by other .
    Ritte et al, "Reversable binding on the starch-related R1 protein to the surface of transitory starch granules", The Plant Journal, 2000 21 (4), pp. 387-391. cited by other .
    Jansen et al, "Analysis of cDNA clones encoding the entire precursor-polypeptide for ferredoxin: NADP+ oxidoreductase from spinach", Current Genetics, 1988, 13: pp. 517-522. cited by other .
    Klosgen et al, "The amyloplast--targeting transit peptide of the waxy protein of maize also mediates protein transport in vitro into chloroplasts", Mol. Gen Getics 1989, 217, pp. 155-161. cited by other .
    Nielsen et al, "Starch Phosphorylation in Potato Tubers Proceeds Concurrently with de Novo Biosynthesis of Starch", Plant Physiol. 1994, 105: pp. 111-117. cited by other .
    Jane et al, "Internal Structure of the potato starch granule revealed by chemical gelatinization", Carbohydrate Research, 247, 1993, pp. 279-290. cited by other .
    Leisy et al, "Expression of a Rice Glutelin promotor in transgenic tobacco", Plant Molecular Biology, 14, 1989, pp. 41-50. cited by other .
    Zheng et al, "5 ' distal and proximal cis-acting regulator elements are required for developmental control of a rice seed storage protein glutelin gene", The Plant Journal, 1993 4(2), pp. 357-366. cited by other .
    Yoshihara et al, "A45-bp proximal region containing AACA and GCN4 motif is sufficient to confer endosperm-specific expression of the rice storage protein glutelin gene, GluA-3" , FEBS Letters 383, 1996, pp. 213-218. cited by other .
    Werr et al, "Structure of the sucrose synthase gene on chromosome 9 of Zea mays L.", The EMBO Journal vol. 4, 1985, pp. 1373-1380. cited by other .
    Anderson et al, "Conservation in wheat high-molecular-weight glutenin gene promotor sequences: comparisons among loci and among alleles of the GLU-B1 locus", Theor. Appln. Genet, (1998), 96, pp. 568-576. cited by other .
    Thomas et al, "Identification of an Enhancer Element for the Endosperm-Specific Expression of High Molecular Weight Glutenin", The Plant Cell, vol. 2, pp. 1171-1180, Dec. 1990. cited by other .
    Sengupta-Gopalan et al, "Developmentally regulated expression of the bean .beta.-phaseolin gene in tobacco seed", Proc. Natl. Acad. Sci. USA, vol. 82, pp. 3320-3324, May 1985. cited by other .
    Bustos et al, "Regulation of .beta.-Glucuronidase Expression in Transgenic Tobacco Plants by an A/T-Rich, cis-Acting Sequence Found Upstream of a French Bean B-Phaseolin Gene", The Plant Cell, vol. 1, pp. 839-853, Sep. 1989. cited by other .
    Pedersen et al, "Cloning and Sequence Analysis Reveal Structural Variation among Related Zein Genes in Maize", Cell, vol. 29, pp. 1015-1026, Jul. 1982. cited by other .
    Quattrocchio et al, "The maize zein gene zE19 contains two distinct promotors which are independently activiated in endosperm and anthers of transgenic Petunia plants", Plant Molecular Biology, 15, pp. 81-93, 1990. cited by other. 

    Primary Examiner: Lewis; Patrick T
    Attorney, Agent or Firm: Reed Smith LLP Marquez, Esq.; Juan Carlos A.

    --------------------------------------------------------------------------------

    Parent Case Text

    --------------------------------------------------------------------------------


    This is a divisional of U.S. Ser. No. 10/794,865 filed Mar. 5, 2004 now U.S. Pat. No. 7,217,816; which is a divisional of U.S. Ser. No. 10/038,224, filed Oct. 19, 2001, now Pat. No. 6,734,340; which claims priority to DE 10052492 filed Oct. 23, 2000 and DE 100 64 805 filed Dec. 22, 2000.
    --------------------------------------------------------------------------------

    Claims

    --------------------------------------------------------------------------------


    The invention claimed is:

    1. A maize starch, wherein the C6 position of the glucose monomer has a phosphate content of at least 1.0 nmol C6 P mg.sup.-1 starch, and wherein the ratio of the C6 phosphate content of the glucose monomer in the C6 position of the amylose component to the C6 phosphate content of the glucose monomer in the C6 position of the starch is less than 0.75.

    2. The maize starch according to claim 1, wherein the C6 position of the glucose monomer has a phosphate content of at least 2.0 nmol C6 P mg.sup.-1 starch.

    3. Maize flour containing maize starch according to claim 1.

    4. A baking mixture or food ingredient containing the maize starch according to claim 1.

    5. A baking mixture or food ingredient containing maize flour according to claim 4.
    --------------------------------------------------------------------------------
     
    Description

    --------------------------------------------------------------------------------


    The present invention relates to monocotyledon plant cells and plants which are genetically modified, wherein the genetic modification consists of the introduction of an extraneous nucleic acid molecule which codes for a protein with the biological activity of an R1 protein. The present invention further relates to means and methods for the production thereof. Plant cells and plants of this type synthesise a modified starch which is characterised in that it has an increased phosphate content and/or a modified phosphorylation pattern and/or an increased final viscosity in an RVA profile and/or a reduced peak temperature in DSC analysis and/or an increased gel strength in the texture analysis compared with starch from corresponding non-genetically modified monocotyledon plants. Therefore, the present invention also relates to the starch which is synthesised from the plant cells and plants according to the invention, and to methods of producing said starch. The present invention further relates to wheat flours which contain said modified starches, and to food products and bakery products which contain said wheat flours and/or starch.

    With regard to the increasing importance which has recently been attached to substances of plant content as renewable sources of raw materials, one of the tasks of biotechnological research is to endeavour to adapt these plant raw materials to the requirements of the industry which processes them. To facilitate the use of renewable raw materials in as many fields of use as possible, it is also necessary to provide a considerable multiplicity of substances.

    Apart from oils, fats and proteins, polysaccharides constitute the important renewable raw materials from plants. In addition to cellulose, starch, which is one of the most important storage materials in higher plants, assumes a central position in polysaccharides.

    Polysaccharide starch is a polymer of chemically uniform basic components, namely glucose molecules. However, it is a very complex mixture of different forms of molecules, which differ with regard to their degree of polymerisation and the occurrence of branched region in the glucose chains. Starch therefore does not constitute a uniform raw material. A distinction is made between two chemically different components of starch: amylose and amylopectin. In typical plants which are used for starch production, such as maize, wheat or potatoes, the synthesised starch consists of up to about 20%-30% of amylose starch and up to about 70%-80% of amylopectin starch.

    Amylose was for a long time considered to be a linear polymer consisting of .alpha.-1,4-glycosidically bonded .alpha.-D-glucose monomers. In more recent studies, however, the presence of about 0.1% of .alpha.-1,6-glycosidic branching sites has been detected (Hizukuri and Takagi, Carbohydr. Res. 134, (1984), 1-10; Takeda et al., Carbohydr. Res. 132, (1984), 83-92). Basically, however, achieving a complete separation of amylose from amylopectin very difficult, so that the quality of the amylose is strongly dependent on the type of separation method selected. In contrast to amylose, amylopectin is more strongly branched and comprises about 4% of branching sites which are formed due to the occurrence of additional .alpha.-1,6-glycoside linkages. Amylopectin constitutes a complexes mixture of differently branched glucose chains. A further significant difference between these two molecules is their molecular weight. Whereas amylose, depending on the origin of the starch, has a molecular weight of 5.times.10.sup.5-10.sup.6 Da, that of amylopectin ranges between 10.sup.7 and 10.sup.8 Da. These two macromolecules can be by distinguished by their molecular weight and by their different physicochemical properties, which are most readily manifested by their different iodine bonding properties.

    A further significant difference between amylose and amylopectin is the relative amounts of trace substances which can exist in association with these macromolecules. Amylose has a high affinity for hydrophobic molecules. In cereals in particular, amylose can be complexed with relatively high amounts of lipids (Morrison, Cereal Foods World 40, (1995), 437-446). On the other hand, amylopectin can contain covalently bonded inorganic phosphate in the form of starch phosphate monoesters, which has not hitherto been described for amylose. High contents of phosphate monoesters are found in particular in starches which are obtained from tubers. Amongst commercially available starches, potato starch has the highest phosphate content, which can range between 10-30 nmol mg.sup.-1 starch In some types of Curcuma the phosphate content can even be 2 to 4 times higher (Bay-Smidt et al., 5th ISPMP Meeting Proceedings, (1997), 741), whilst it is about 100 times less in cereals (Kasemsuwan and Jane, Cereal Chem. 73, (1996), 702-707). In contrast to starches from tubers, roots and legumes, the detectable phosphate in cereal starches (monocotyledon plants) rarely occurs in the form of starch monoester derivatives, but mainly occurs in the form of phospholipids (Jane et al., Cereal Foods World 41, (1996), 827-832).

    Apart from its amylose/amylopectin ratio and phosphate content, the functional properties of starch are influenced by its molecular weight, its pattern of side chain distribution, its content of ions, its lipid and protein content, etc. Important functional properties which should be cited here are the solubility, the retrogradation behaviour, the water absorption capacity, the film-forming properties, the viscosity, the conglutination properties, the freeze-thaw stability, the stability in relation to acids, the gel strength, etc. The starch grain size can also be important for various applications.

    In principle, the phosphate content can be modified either by genetic engineering approaches or by the subsequent chemical phosphorylation of native starches (see, for example: Starch Chemistry and Technology. Eds. R. L. Whistler, J. N. BeMiller and E. F. Paschall. Academic Press, New York, 1988, 349-364). Chemical modifications are generally costly and time-consuming, however, and result in starches, the physicochemical properties of which can differ from those of starches modified in vivo.

    Since starches from monocotyledon wild-type plants, particularly from cereal plants (wheat, rice, maize, oats, millet, rye), only have a very low content of phosphate in the form of starch phosphate monoesters (Lim et al. Cereal Chem. 71, (1994), 488), one object of the present invention is to provide monocotyledon plants which synthesise starches with an increased phosphate content (content of starch phosphate monoesters) and modified physicochemical properties compared with corresponding wild-type plant cells and plants.

    The underlying object of the present invention is thus to provide genetically modified monocotyledon plant cells and plants which synthesise starches with modified structural and/or functional properties compared with corresponding non-genetically modified wild-type plant cells and plants, and is also to provide starch, the structural and/or functional properties of which differ from those of starch from corresponding non-genetically modified wild-type plant cells and plants and from those of chemically modified starch, and which is thus more suitable for general and/or special industrial purposes of use.

    This object is achieved by the provision of the embodiments described in the claims, because it has surprisingly been found that the introduction of an extraneous nucleic acid molecule into the genome of monocotyledon plant cells and plants results in a modification of the structural and/or functional properties of the starch which is synthesised in said monocotyledon plant cells and plants.

    Expression of the extraneous nucleic acid molecule is primarily advantageous in starch-storing organs of monocotyledon plants, particularly of wheat plants, and leads to an increase of the phosphate content and modification of the viscosity properties of the starch which can be isolated from the starch-storing organs compared with starches which can be isolated from starch-storing organs of corresponding non-genetically modified wild-type plants, particularly wheat plants. Moreover, the starches according to the invention are distinguished from chemically phosphorylated starches by a modified phosphorylation pattern and modified viscosity properties, and after conglutination of the starches and gel formation are also distinguished by modified gel strengths.

    Thus the present invention relates to monocotyledon genetically modified plant cells, wherein the genetic modification consists of the introduction of at least one extraneous nucleic acid molecule and the extraneous nucleic acid molecule is selected from the group consisting of: a) nucleic acid molecules which comprise the coding region of the nucleotide sequence represented in Seq ID No. 1; b) nucleic acid molecules which encode an R1 protein from Solanum tuberosum with the amino acid sequence given in Seq ID No. 2; c) nucleic acid molecules which constitute a derivative of the nucleotide sequence given in Seq ID No. 1; and d) nucleic acid molecules which constitute fragments of the nucleic acid molecules cited in (a), (b) or (c).

    In the sense of the present invention, the term "genetically modified" means that the genetic information of the plant cell is modified by the introduction of an extraneous nucleic acid molecule and that the presence or expression of the extraneous nucleic acid molecule results in a phenotypic modification. The term "phenotypic modification" preferably means a measurable modification of one or more functions of the cells. For example, the genetically modified plant cells according to the invention exhibit a modified expression pattern. In the sense of the present invention, the term "genetically modified" means that the monocotyledon plant cell according to the invention contains at least one extraneous nucleic acid molecule which is integrated in the genome in a stable manner.

    In the sense of the present invention, the term "extraneous nucleic acid molecule" is to be understood to mean a nucleic acid molecule which codes for a protein with the biological activity of an R1 protein, preferably an R1 protein from Solanum tuberosum, and which does not occur naturally in corresponding non-genetically modified wild-type plant cells. The extraneous nucleic acid molecule is preferably a recombinant molecule which consists of different elements, the combination or specific spatial arrangement of which does not occur naturally in plant cells. The monocotyledon plant cells according to the invention contain at least one extraneous nucleic acid molecule, wherein the latter is preferably linked to regulatory DNA elements which ensure transcription in plant cells, particularly with a promoter.

    An example of an extraneous nucleic acid molecule which codes for an R1 protein from Solanum tuberosum is represented in SEQ ID No. 1. Nucleotide sequences which code for an R1 protein from Solanum tuberosum have also been described in WO 97/11188 A1 and by Lorberth et al. (Nature Biotech. 16, (1998), 473-477).

    The important characteristics of R1 proteins from Solanum tuberosum are i) their amino acid sequence (see SEQ ID No. 2, for example); ii) their location in the stroma of plastids of plant cells, wherein they can exist there both in a form bound to starch grains and in soluble form; and iii) their capacity for influencing the degree of phosphorylation of starch in plants. For example, inhibition of the R1 gene which codes for an R1 protein from potatoes in transgenic potato plants results in a reduction of the phosphate content of the starch which can be isolated from the potato tubers. Furthermore, Lorberth et al. showed that the R1 protein from Solanum tuberosum is capable of phosphorylating bacterial glycogen if the corresponding R1 cDNA is expressed in E. coli (Lorberth et al., Nature Biotech. 16, (1998), 473-477). Ritte et al. (Plant J. 21, (2000), 387-391) showed that the R1 protein from Solanum tuberosum binds reversibly to starch grains in potato plants, wherein the strength of binding to the starch grain depends on the metabolic status of the plant. In starch grain-bound form, the protein in potato plants mainly occurs in leaves which are kept in the dark. After the leaves are illuminated, however, the protein is mainly present in a soluble form which is not bound to starch grains.

    Moreover, inhibiting the expression of the R1 gene from potatoes in transgenic potato plants results in a "starch-excess" phenotype, i.e. the leaves of corresponding plants have an increased content of starch (Lorberth et al., Nature Biotech. 16, (1998), 473-477). In addition, the tubers of such potato plants are distinguished in that after cold storage they exhibit reduced "cold-induced sweetening" (Lorberth et al., Nature Biotech. 16, (1998), 473-477).

    In principle, the extraneous nucleic acid molecule which codes for an R1 protein can originate from any kind of potato or potato plant, preferably from potatoes of the Tomensa, Desiree, Tempora and Thomana varieties.

    In one preferred embodiment, the extraneous nucleic acid molecule has the nucleotide sequence represented in SEQ ID No. 1.

    In a further preferred embodiment the invention comprises the extraneous nucleic acid molecule of the coding region of the nucleotide sequence represented in SEQ ID No. 1.

    In a further preferred embodiment of the invention, the extraneous nucleic acid molecule encodes an R1 protein from Solanum tuberosum which has the amino acid sequence given in SEQ ID No. 2.

    In yet another embodiment of the invention, the extraneous nucleic acid molecules comprise the coding region of the mature (without a plastidary signal peptide) protein (bp 447-bp 4607 of the nucleotide sequence given in SEQ ID No. 1). Instead of the plastidary N-terminal signal peptide of the R1 protein from potatoes (amino acids 1 to 77 coded by nucleotides 216 to 446 of the nucleotide sequence given in SEQ ID No. 1), in this embodiment of the invention the extraneous nucleic acid molecules comprise a heterologous plastidary signal sequence, i.e. a signal sequence which does not exist naturally in association with the mature R1 protein. Plastidary signal sequences are known to one skilled in the art.

    The signal sequence of Ferrodoxin:NADP.sup.+ oxidoreductase (FNR) from spinate can be used as a plastidary signal sequence, for example. This sequence contains the 5'-non-translated region as well as the flanking transit peptide sequence of the cDNA of the plastidary protein Ferrodoxin:NADP.sup.+ oxidoreductase from spinate (nucleotides -171 to +165; Jansen et al., Current Genetics 13, (1988), 517-522).

    In addition, for example, the transit peptide of the waxy protein from maize plus the first 34 amino acids of the mature waxy protein can be used as a signal sequence (Klosgen et al., Mol. Gen. Genet. 217, (1989), 155-161). Furthermore, the transit peptide of the waxy protein from maize can be used without the first 34 amino acids of the mature waxy protein.

    In a further preferred embodiment of the invention, the extraneous nucleic acid molecule constitutes a derivative of the nucleotide sequence given in SEQ ID No. 1.

    In the sense of the present invention, the expression "derivative" means that the sequences of these molecules differ at one or more positions from the nucleotide sequence given in SEQ ID No. 1 and exhibit a high degree of homology with the coding region of the nucleotide sequence given in SEQ ID No. 1. In addition, derivatives are distinguished in that they code for a protein with the biological activity of an R1 protein, preferably of an R1 protein from Solanum tuberosum. In the sense of the present invention, "homology" means a sequence identity of nucleotide sequences of at least 65%, particularly of at least 85%, more particularly an identity of at least 90%, preferably more than 95% and most preferably more than 98%. Differences from the nucleic acid molecules described above can occur due to deletion, addition, substitution, insertion or recombination.

    The degree of homology is preferably determined by comparing the sequence of the respective nucleotide sequence with the coding region of SEQ ID No. 1, particularly with region of SEQ ID No. 1 (bp447-bp4607) which codes for the mature protein of the nucleotide sequence given in SEQ ID No. 1). If the sequences to be compared are of different lengths, the degree of homology preferably refers to the percentage of nucleotides in the shorter nucleotide sequence which are identical to the nucleotides of the longer sequence, i.e. the sequence identity is determined for the region in which the respective nucleotide sequences overlap. Sequence comparisons can be made using known computer programs, such as the ClustalW program (Thompson et al., Nucleic Acids Research 22, (1994), 4673-4680), which is distributed by Julie Thompson (Thompson@EMBL-Heidelberg.DE) and Toby Gibson (Gibson@EMBL-Heidelberg.DE; European Molecular Biology Laboratory, Meyerhofstrasse 1, D 69117 Heidelberg, Germany). Clustal W can also be downloaded from various internet sites, e.g. that of the IGBMC (Institut de Genetique et de Biologie Moleculaire et Cellulaire, B.P.163, 67404 Illkirch Cedex, France; ftp://ftp-igbmc.u-strasbq.fr/pub/) and that of the EBI (European Bioinformatics Institute) (ftp://ftp.ebi.ac.uk/pub/software/), as well as from internet sites with links to the EBI (European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 ISD, UK).

    When using the ClustalW program (Version 1.8), the default values of the various parameters are employed. In the case of DNA sequence comparisons, these parameters have the following values: KTUPLE=2, TOPDIAGS=4, PAIRGAP=5, DNAMATRIX:IUB, GAPOPEN=10, GAPEXT=5, MAXDIV=40, TRANSITIONS: unweighted.

    In the case of protein sequence comparisons the default values of the parameters of the ClustalW program are likewise used. These parameters have the following values: KTUPLE=1, TOPDIAG=5, WINDOW=5, PAIRGAP=3, GAPOPEN=10, GAPEXTEND=0.05, GAPDIST=8, MAXDIV=40, MATRIX=GONNET, ENDGAPS(OFF), NOPGAP, NOHGAP.

    The degree of homology can be determined, for example, using known computer programs such as Mview (http://www.sacseeucsf.edu/documentation/segsoftware/mview; Brown, N. P., Leroy C., Sander C. (1998). MView: A Web compatible database search or multiple alignment viewer. Bioinformatics, 14(4):380-381).

    In the sense of the present invention, "homology" also means that there is functional and/or structural equivalence between the respective nucleic acid molecules or the proteins which they encode. The nucleic acid molecules which are homologous with the nucleic acid molecules described in SEQ ID No. 1 and which constitute derivatives of these molecules are variations of these molecules which constitute modifications which perform the same biological function, and which in vivo are also capable of increasing the phosphate content of starches in monocotyledon plants. These can be either naturally occurring variations, for example sequences from other types of potatoes, or mutations, wherein said mutations may have been formed naturally or may have been introduced by targeted mutagenesis.

    In a further embodiment of the invention, the derivative of SEQ ID No. 1 comprises allelic variants of the nucleic acid molecule given in SEQ ID No. 1. These allelic variants are naturally occurring variants which are capable of increasing the phosphate content of starches.

    In a further embodiment of the invention, the extraneous nucleic acid molecule constitutes a fragment of the extraneous nucleic acid molecule which is defined according to the invention.

    In the sense of the present invention, the term "fragment" denotes parts of the extraneous nucleic acid molecule which code for a biologically active, preferably enzymatically active, part of the R1 protein.

    A biologically active part of an R1 protein is distinguished in that in planta it can cause an increase of the phosphate content with superexpression of the extraneous nucleic acid molecule and/or that after expression in E. coli it facilitates phosphorylation of glycogen (see WO 97/11188 A1, Example 9).

    The proteins which are encoded by the different variants (fragments, derivatives, allelic variants) of the extraneous nucleic acid molecule exhibit defined general characteristics. Examples of the latter include the biological activity, the enzymatic activity, or a similar primary structure which can be investigated by means of the protein homology comparisons described above. The amino acid sequences of the proteins exhibit a mutual homology of at least 60%, preferably at least 85%, particularly at least 95% and most preferably at least 97%.

    In addition to the characteristics described above, the extraneous nucleic acid molecules may be characterised in that they code for proteins with the biological activity of R1 proteins, which comprise at least one, preferably at least five, particularly at least 10 and most preferably all of the following characteristic peptide motifs:

    TABLE-US-00001 DKAAET, (SEQ ID No. 3) IADME, (SEQ ID No. 4) VWMRFM, (SEQ ID No. 5) MQEWHQ, (SEQ ID No. 6) LGHYM, (SEQ ID No. 7) ERGYEE, (SEQ ID No. 8) KAVLDR, (SEQ ID No. 9) LSSLL, (SEQ ID No. 10) IPDGAV, (SEQ ID No. 11) KVCFAT, (SEQ ID No. 12) ISADEF, (SEQ ID No. 13) PFGVFE, (SEQ ID No. 14) SSGDD, (SEQ ID No. 15) SFICKK. (SEQ ID No. 16)

    Amongst other differences, the plant cells according to the invention can also be distinguished from naturally occurring plant cells in that they contain an extraneous nucleic acid molecule which does not occur naturally in these cells, or that a molecule such as this is integrated at a place in the genome of the cell at which it does not occur naturally, i.e. in a different genomic environment. Moreover, transgenic plant cells of this type according to the invention can be distinguished from naturally occurring plant cells in that they contain at least one copy of the extraneous nucleic acid molecule which is integrated in a stable manner in their genome contain, optionally in addition to copies of a molecule such as this which occur naturally in the cells. If the nucleic acid molecules which are introduced into the cells are additional copies of molecules which already occur naturally in the cells, the plant cells according to the invention can be distinguished in particular from naturally occurring plant cells in that these additional copies are located at sites in the genome at which they do not occur naturally. This can be detected subsequently by means of Southern blotting analysis, for example.

    Furthermore, the plant cells according to the invention are preferably distinguished from naturally occurring plant cells by at least one of the following features: if the nucleic acid molecule which is introduced is heterologous with respect to the plant the transgenic plant cells according to the invention comprise transcripts of the nucleic acid molecules which are introduced, in fact even in those organs in which no transcripts can be detected in wild-type plants. Plant cells according to the invention preferably contain transcripts of the extraneous nucleic acid molecules. These can be detected by Northern blotting analysis, for example. Plant cells according to the invention preferably contain a protein which is encoded by an introduced extraneous nucleic acid molecule. This additional protein can be detected by immunological methods for example, particularly by Western blotting analysis.

    In one preferred embodiment, the plant cells and plants according to the invention exhibit an increased biological activity of the R1 protein compared with corresponding non-genetically modified wild-type plant cells and wild-type-plants. In connection with the present invention, an "increased biological activity of the R1 protein" can be determined, for example, by measuring the phosphate content of the starches which are synthesised in the plant cells and plants according to the invention. Compared with starches from corresponding non-genetically modified wild-type plant cells, starches from the plant cells according to the invention, which exhibit increased biological activity of the R1 protein, are distinguished in that they synthesise a starch with an increased phosphate content, preferably an increased phosphate content in the C6 position of the glucose monomer.

    Moreover, an increased biological activity of the R1 protein can be determined by measuring the amount of R1-transcripts, e.g. by Northern blotting analysis, compared with the amount of R1-transcripts of corresponding non-genetically modified wild-type plants.

    Furthermore, an increased biological activity of the R1 protein can be determined by measuring the amount of R1 protein, e.g. by Western blotting analysis, compared with the amount of R1 protein of corresponding non-genetically modified wild-type plants.

    It has been found that the monocotyledon plant cells according to the invention synthesise a starch with an increased phosphate content in the C6 position of the glucose monomer and/or a modified phosphorylation pattern and/or modified viscosity properties compared with starch from corresponding non-genetically modified plant cells of wild-type-plants.

    Therefore, the present invention preferably relates to plant cells according to the invention which synthesise a starch has an increased phosphate content in the C6 position of the glucose monomer and/or a modified phosphorylation pattern and/or modified viscosity properties compared with starch from corresponding non-genetically modified plant cells of wild-type-plants.

    In the sense of the present invention, the term "phosphate content" denotes the content of phosphate which is covalently bonded in the form of starch phosphate monoesters.

    In the sense of the present invention, the term "C6 position" is to be understood to mean phosphate groups, which are bonded to the glucose monomer of the starch at carbon atom position "6".

    In connection with the present invention, the expression "increased phosphate content in the C6 position" is to be understood to mean that glucose monomer phosphate groups can be detected in the in the C6 position by means of an optical-enzymatic test (Nielsen et al., Plant Physiol. 105, (1994), 111-117, see methods).

    The expression "increased phosphate content in the C6 position" is preferably understood to mean an increase in the phosphate content of the starch in the C6 position of the glucose monomer by at least 20%, preferably by at least 50% and most preferably by at least 100%, compared with the phosphate content of starch from corresponding non-genetically modified wild-type-plants.

    In principle, the C2, C3 and C6 positions of the glucose units can be phosphorylated in the starch in vivo. In connection with the present invention, the phosphate content in the C6 position (=C6 P content) can be determined by a glucose-6-phosphate determination by means of an optical-enzymatic test (Nielsen et al., Plant Physiol. 105, (1994), 111-117) (see methods).

    In the sense of the present invention, the term "modified phosphorylation pattern means that the total phosphate content of phosphate groups which are covalently bonded to the starch within the various layers of the starch grain is modified compared with chemically phosphorylated starches which are produced from starches from corresponding non-genetically modified plants. Chemically phosphorylated starches are distinguished by a phosphate gradient inside the starch grains, wherein the outer layers are generally more strongly phosphorylated than are the inner layers. In contrast to this, the starches according to the invention are distinguished in that the phosphate groups are distributed differently over the various layers of the starch grain, i.e. the starches according to the invention can be characterised in that they do not comprise the gradients from the outside to the inside which are typical of chemically phosphorylated starches.

    Methods of investigating the phosphorylation pattern of starch are known to one skilled in the art (see Jane and Shen, Carbohydrate Research 247, (1993), 279-290; Gough and Pybus, Staerke 25, (1973), 123-130, for example). These methods are based on step-wise chemical conglutination of the various layers of the starch grains, in which the conglutinated layers of the starch grains are mechanically removed in steps. This shelling procedure is followed by a determination of the total phosphate content of the various starch grain layers by standard methods.

    In the sense of the present invention, the term "chemically phosphorylated starch" is to be understood to mean a starch which is produced by the chemical phosphorylation of native starch from corresponding non-genetically modified plant cells and/or plants. In connection with the present invention, chemically phosphorylated starch is preferably distinguished by an amylose content which is comparable with the amylose content of the starches according to the invention. During the chemical phosphorylation of native starches, the phosphate content in the C6 position is adjusted by selecting suitable test conditions so that the phosphate content in the C6 position of the chemically phosphorylated starch is identical to and/or comparable with the phosphate content in the C6 position of the glucose monomer of the starches according to the invention.

    In connection with the present invention, the term "modified viscosity properties" is to be understood in particular to mean an increase in the final viscosity in an RVA profile and/or a lowering of the peak temperature in DSC analysis.

    In a further preferred embodiment, the plant cells according to the invention synthesise a starch which has an increased final viscosity compared with starch from corresponding non-genetically modified wild-type plants.

    In connection with the present invention, the term "final viscosity" is to be understood to mean the viscosity which can be determined from a viscosity profile (see FIG. 1) and which is denoted there as "final viscosity=Fin". The viscosity profile can be obtained by means of a Rapid Visco Analyzer (RVA) (Newport Scientific Pty Ltd, Investment Support Group, Warriewood, NSW 2102, Australia). In the analysis of wheat starches, the viscosity profile is determined by the following procedure: 2.5 g starch (dry substance) are taken up in 25 ml H.sub.2O and used for analysis in a Rapid Visco Analyzer (Newport Scientific Pty Ltd., Investment Support Group, Warriewood NSW 2102, Australia). The instrument is operated according to the manufacturer's instructions. The complete temperature programme is illustrated schematically in FIG. 1. Performing an RVA analysis is described in detail below (see methods).

    In the sense of the present invention, the term "increased final viscosity" means that the final viscosity is increased by at least 10%, preferably by at least 30%, particularly by at least 50% and most preferably by at least 80% compared with starches from corresponding non-genetically modified wild-type plant cells, wherein the final viscosity can be increased by 1000% at most, preferably by 500% at most, particularly by 250% at most, compared with starches from corresponding non-genetically modified wild-type plant cells.

    In a further preferred embodiment, the plant cells according to the invention synthesise a starch which has an identical or comparable phosphate content in the C6 position of the glucose monomer and/or a reduced peak temperature compared with starch from corresponding non-genetically modified wild-type plants and/or compared with chemically phosphorylated starches.

    In the context of the present invention, the term "peak temperature" should be understood to mean the temperature Tp which can be determined by means of differential scanning calorimetry (DSC), which is known to one skilled in the art. The peak temperature is the temperature which can generally be assigned to the first peak maximum of the DSC curve. It can be determined, for example, using an instrument supplied by Perkin Elmer (instrument designation: DSC-7) using capsules of large volume, wherein the sample to be investigated comprises a ratio of starch to total water content of about 1:4 and measurements are made over a temperature range from 10.degree. C. to 160.degree. C. at a heating rate of 10.degree. C./min (see Example 4).

    The term "reduced peak temperature" Tp means that compared with starches from corresponding non-genetically modified wild-type plant cells the peak temperature Tp is reduced by at least 1.5.degree. C., preferably by at least 2.5.degree. C., particularly by at least 4.degree. C. and most preferably by at least 6.degree. C., and is reduced at most by 5.degree. C., by 12.degree. C. or by 9.degree. C.

    In a further preferred embodiment, the present invention relates to plant cells according to the invention which synthesise a starch which after conglutination forms a gel, which has an increased gel strength compared with a gel formed from starch from corresponding non-genetically modified wild-type plant cells.

    In the sense of the present invention, the term "increased gel strength" is to be understood to mean an increase gel strength by at least 20%, particularly by at least 50%, preferably by at least 80% and most preferably by at least 100%, with the maximum reduction being 500% at most or 250% at most compared with the gel strength of starch from corresponding non-genetically modified wild-type plant cells. In connection with the present invention, the gel strength can be determined by means of a texture analyser under the conditions described below (see methods).

    In a further embodiment of the invention, the increase in the phosphate content of the starches can relate to the amylopectin component of the starch. Therefore, the present invention also relates to plant cells according to the invention which synthesise a starch, the amylopectin component of which is phosphorylated and the amylose component of which has a reduced total phosphate content compared with the amylose component of corresponding chemically phosphorylated starches with the same starch phosphate content in the C6 position of the glucose monomer.

    Therefore, in contrast to chemically phosphorylated starches with the same phosphate content in the C6 position of the glucose monomer, the starches of the plant cells according to the invention are distinguished in that that the amylose component of the starch from the plant cells according to the invention has a reduced total phosphate content and/or a reduced phosphate content in the C6 position of the glucose monomer compared with the amylose component of chemically phosphorylated starch with the same phosphate content in the C6 position of the glucose monomer, which is produced from starch, which preferably has a comparable amylose content, from corresponding non-genetically modified plants.

    In connection with the present invention, the term "total phosphate content" is to be understood to mean the content of phosphate which is covalently bound in the form of starch phosphate monoesters in the C2, C3 and C6 positions of the glucose units.

    According to the invention, the content of phosphorylated non-glucans, such as phospholipids, is not included under the term "total phosphate content". Phosphorylated non-glucans therefore have to be quantitatively separated before the determination of the total phosphate content.

    Methods of separating phosphorylated non-glucans (e.g. phospholipids) from starch are known to one skilled in the art.

    In the sense of the present invention, the term "reduced total phosphate content" is to be understood to mean a reduction of the total phosphate content by at least 5%, particularly by at least 20%, preferably by at least 50% and most preferably by at least 80%, compared with the total phosphate content of the amylose component of a chemically phosphorylated starch with the same C6 phosphate content which is produced from starch from corresponding non-genetically modified plants. Methods of determining of the total phosphate content are known to one skilled in the art and are described below (see methods).

    In the sense of the present invention, the term "reduced phosphate content in the C6 position of the glucose monomer" should be understood to mean a reduction of the phosphate content in the C6 position of the glucose monomer of the amylose component by at least 10%, particularly by at least 20%, preferably by at least 50% and most preferably by at least 80% compared with the phosphate content in the C6 position of the glucose monomer of the amylose component of a chemically phosphorylated starch of the same C6 phosphate content which is produced from starch from corresponding non-genetically modified plants.

    Methods of determining of the phosphate content in the C6 position of the glucose monomer are known to one skilled in the art and are described below (see methods).

    In the sense of the present invention the term "amylopectin component" is to be understood to mean the amylopectin of the starch.

    In the sense of the present invention, term "amylose component" is to be understood to mean the amylose of the starch.

    Methods of separating amylose and amylopectin are known to one skilled in the art. For example, the amylose component can be obtained by aqueous leaching of the starch, as described, for example, by Roger & Colonna (International Journal of Biological Macromolecules 19, (1996), 51-61).

    In a further preferred embodiment of the present invention, the starches according to the invention are additionally characterised in that the ratio of the C6 phosphate content of the glucose monomer in the C6 position of the amylose component to the C6 phosphate content of the glucose monomer in the C6 position of the starch is less than 075, particularly less than 0.5, preferably less than 0.25 and most preferably less than 0.20. In contrast to chemically phosphorylated starches, the starches according to the invention are distinguished in that the major part of the phosphate in the C6 position of the glucose monomer is detected in the amylopectin component of the starch and not in the amylose component.

    The plant cells according to the invention originate from monocotyledon plants. They are preferably plant cells from plants which are used in agriculture, i.e. from plants, which are cultivated by humans for the purpose of nourishment or for technical purposes, particularly industrial purposes. Thus the present invention preferably relates to plant cells from starch-synthesising or starch-storing plants, e.g. rye, barley, oats, wheat, millet, rice or maize.

    In one preferred embodiment of the present invention, the plant cells according to the invention originate from a plant of the group consisting of wheat, rice, barley, oats, rye and maize. Plant cells from wheat, rice and maize plants are preferred; plant cells from wheat plants are particularly preferred.

    In one particularly preferred embodiment, the plant cells according to the invention synthesise a starch which in the C6 position of the glucose monomer has a phosphate content of at least 0.1 nmol C6 P mg.sup.-1 starch, particularly at least 0.5 nmol C6 P mg.sup.-1, preferably at least 1 nmol C6 P mg.sup.-1 starch, more preferably at least 2 nmol C6 P mg.sup.-1 starch, most preferably at least 5 nmol C6 P mg.sup.-1 starch, most particularly preferably at least 10 nmol C6 P mg.sup.-1 starch, wherein the plant cells according to the invention synthesise a starch which in the C6 position of the glucose monomer has a phosphate content of 100 nmol C6 P mg.sup.-1 starch at most, particularly 50 nmol C6 P mg.sup.-1 starch at most, and most particularly 25 nmol C6 P mg.sup.-1 starch at most.

    In a further embodiment of the invention, the plant cells according to the invention can synthesise a starch which in the C6 position of the glucose monomer has a phosphate content of at least 15 nmol C6 P mg.sup.-1 starch, wherein the plant cells according to the invention synthesise a starch which in the C6 position of the glucose monomer have a phosphate content of 100 nmol C6 P mg.sup.-1 starch at most, particularly 50 nmol C6 P mg.sup.-1 starch at most, and most particularly 25 nmol C6 P mg.sup.-1 starch at most.

    In a further embodiment, the present invention relates to a method of producing a plant cell according to the invention, wherein a cell of a monocotyledon plant is genetically modified, and wherein the genetic modification consists of the introduction of at least one extraneous nucleic acid molecule.

    There is a multiplicity of techniques which are available for the transfer of DNA into a plant host cell. These techniques include the transformation of plant cells with T-DNA using Agrobacterium tumefaciens or Agrobacterium rhizogenes as a transformation agent, fusion of protoplasts, injection, electroporation of DNA, the introduction of DNA by means of biolistic techniques and other possible techniques. The use of the transformation of plant cells facilitated by agrobacteria has been intensively investigated and is satisfactorily described in EP 120516; Hoekema, I N: The Binary Plant Vector System Offsetdrukkerij Kanters B. V., Alblasserdam (1985), Chapter V; Fraley et al., Crit. Rev. Plant Sci. 4, 1-46 and An et al. EMBO J. 4, (1985), 277-287. For the transformation of potatoes, see Rocha-Sosa et al., EMBO J. 8, (1989), 29-33.), for example.

    The transformation of monocotyledon plants has in the meantime been routinely accomplished by means of a biolistic technique and by means of agrobacteria (Komari et al., (1998), Advances in cereal gene transfer; Current Opinion in Plant Biotechnology 1, page 161 et seq.; Bilang et al. (1999), Transformation of Cereals, Genetic Engineering, 12, pages 113-148, edited by: J K Setlow, Kluwer Academic/Plenum Publisher, New York). Vectors based on agrobacteria have been described (Chan et al., Plant Mol. Biol. 22, (1993), 491-506; Hiei et al., Plant J. 6, (1994) 271-282; Deng et al, Science in China 33, (1990), 28-34; Wilmink et al., Plant Cell Reports 11, (1992), 76-80; May et al., Bio/Technology 13, (1995), 486-492; Conner and Domisse, Int. J. Plant Sci. 153 (1992), 550-555; Ritchie et al, Transgenic Res. 2, (1993), 252-265). Alternative systems for the transformation of monocotyledon plants include transformation by means of a biolistic technique (Wan and Lemaux, Plant Physiol. 104, (1994), 37-48; Vasil et al., Bio/Technology 11 (1993), 1553-1558; Ritala et al., Plant Mol. Biol. 24, (1994), 317-325; Spencer et al., Theor. Appl. Genet. 79, (1990), 625-631), protoplast transformation, electroporation of partially permeabilised cells, and the introduction of DNA by means of glass fibres. In particular, the transformation of maize has been described many times in the literature (see WO 95/06128, EP 0513849, EO 0465875, EP 292435; Fromm et al., Biotechnology 8, (1990), 833-844; Gordon-Kamm et al., Plant Cell 2, (1990), 603-618; Koziel et al., Biotechnology 11 (1993), 194-200; Moroc et al., Theor. Appl. Genet. 80, (1990), 721-726, for example).

    The successful transformation of other types of cereals has also been described, e.g. for barley (Wan and Lemaux, see above; Ritala et al., see above; Krens et al., Nature 296, (1982), 72-74) and for wheat (Becker et al., Plant J. 5 (2), (1994), 229-307; Nehra et al., Plant J. 5, (1994), 285-297).

    Various transformation methods have been described for rice, e.g. transformation facilitated by agrobacteria (Hiei et al., Plant J. 6-(1994), 271-282; Hiei et al., Plant Mol. Biol. 35 (1997), 205-218; Park et al., J. Plant Biol. 38 (1995), 365-371), protoplast transformation (Datta, In "Gene transfer to plants", Potrykus, Spangenberg (Eds.), Springer-Verlag, Berlin, Heidelberg, 1995, 66-75; Datta et al., Plant Mol. Biol. 20 (1992), 619-629; Sadasivam et al., Plant Cell Rep. 13 (1994), 394-396), a biolistic technique for plant transformation (Li et al., Plant Cell Rep. 12 (1993), 250-255; Cao et al., Plant Cell Rep. 11 (1992), 586-591; Christou, Plant Mol. Biol. (1997), 197-203), and electroporation (Xu et al., In "Gene transfer to plants", Potrykus, Spangenberg (Eds.), Springer-Verlag, Berlin, Heidelberg, 1995, 201-208).

    The present invention further relates to plants containing the plant cells according to the invention and/or which can be produced by regeneration from plant cells according to the invention. These plants are preferably useful monocotyledon plants, e.g. rye, barley, oats, wheat, millet, rice and maize. Wheat, rice and maize are preferred; wheat is particularly preferred.

    The plants according to the invention synthesise a modified starch, the phosphate content of which and/or the phosphorylation pattern of which and/or the viscosity properties of which differ from those of starches from corresponding non-genetically modified wild-type-plants, as described in connection with the plant cells according to the invention.

    Therefore, the present invention also relates to plants according to the invention which synthesise a starch, which has an increased phosphate content in the C6 position of the glucose monomer and/or exhibits a modified phosphorylation pattern and/or modified viscosity properties compared with starch from corresponding non-genetically modified plants.

    The statements made in connection with the plant cells according to the invention are applicable with regard to the increase of the phosphate content in the C6 position of the glucose monomer of the starch, the modification of the phosphorylation pattern and the modification of the viscosity properties of the starch.

    The present invention preferably relates to plants according to the invention which synthesise a starch after conglutination forms a gel, which has an increased gel strength compared with a gel formed from starch from corresponding non-genetically modified wild-type-plants.

    The term "increased gel strength" was defined in connection with the plant cells according to the invention.

    In a further preferred embodiment of the invention, the plants according to the invention, preferably wheat plants, synthesise a starch, preferably wheat starch, which in the C6 position of the glucose monomer has a phosphate content of at least 0.1 nmol C6 P mg.sup.-1 starch, particularly at least 0.5 nmol C6 P mg.sup.-1, preferably at least 1 nmol C6 P mg.sup.-1 starch, most preferably at least 2 nmol C6 P mg.sup.-1 starch, particularly at least 5 nmol C6 P mg.sup.-1 starch, quite most preferably at least 10 nmol C6 P mg.sup.-1 starch, wherein the plants according to the invention synthesise a starch which in the C6 position of the glucose monomer has a phosphate content of 100 nmol C6 P mg.sup.-1 starch at most, particularly 50 nmol C6 P mg.sup.-1 starch at most, or 25 nmol C6 P mg.sup.-1 starch at most.

    In a further embodiment of the invention, the plants according to the invention can synthesise a starch which in the in the C6 position of the glucose monomer has a phosphate content of at least 15 nmol C6 P mg.sup.-1 starch, wherein the plants according other invention synthesise a starch which in the C6 position of the glucose monomer has a phosphate content of 100 nmol C6 P mg.sup.-1 starch at most, particularly 50 nmol C6 P mg.sup.-1 starch at most or 25 nmol C6 P mg.sup.-1 starch at most.

    In a further preferred embodiment of the invention, the plants according to the invention synthesise the starch according to the invention in the starch-storing organs of the plant according to the invention.

    In a most preferred embodiment, the plants according to the invention synthesises a starch in its starch-storing organs which has an increased phosphate content in the C6 position of the glucose monomer and/or a modified phosphorylation pattern and/or modified viscosity properties compared with starch from starch-storing organs of corresponding non-genetically modified wild-type plants.

    In this connection, the expression "starch-storing organs" is to be understood to mean those organs, e.g. the grains of maize, rice and wheat plants, which incorporate stored starch, in contrast to those organs, such as leaves, which only synthesise starch transiently.

    Expression of the extraneous nucleic acid molecule is particularly advantageous in starch-storing organs of monocotyledon plants, especially in wheat plants, and results in an increase of the phosphate content of the starches which can be isolated from the starch-storing organs compared with starches which can be isolated from the starch-storing organs of corresponding non-genetically modified wild-type plants, particularly wheat plants.

    Expression of the extraneous nucleic acid molecule in starch-storing organs of monocotyledon plants can be achieved firstly by the use of constitutive promoters, e.g. the promoter of the 35S RNA of the cauliflower mosaic virus (see U.S. Pat. No. 5,352,605, for example) and the ubiquitin promoter of maize (see U.S. Pat. No. 5,614,399, for example).

    Promoters are preferably used which are specific for starch-storing organs, e.g. endosperm-specific promoters, such as the glutelin promoter (Leisy et al., Plant Mol. Biol. 14, (1990), 41-50; Zheng et al., Plant J. 4, (1993), 357-366; Yoshihara et al., FEBS Lett. 383, (1996), 213-218), the shrunken-1 promoter (Werr et al., EMBO J. 4, (1985), 1373-1380), the HMW promoter of wheat (Anderson, Theoretical and Applied Genetics 96, (1998), 568-576, Thomas, Plant Cell 2 (12), (1990), 1171-1180), the USP promoter, the phaseolin promoter (Sengupta-Gopalan, Proc. Natl. Acad. Sci. USA 82 (1985), 3320-3324, Bustos, Plant Cell 1 (9) (1989), 839-853) or promoters of zein genes from maize (Pedersen et al., Cell 29, (1982), 1015-1026; Quatroccio et al., Plant Mol. Biol. 15 (1990), 81-93) or caryopsis-specific promoters of GBSSI (granule bound starch synthase 1) (DE10041861.9) and of SSII (soluble starch synthase II) from wheat (DE10032379.0).

    In one particularly preferred embodiment, the plants according to the invention exhibit R1 gene expression in the starch-storing organs of said plants.

    R1 gene expression can be determined, for example, by measuring the amount of R1 transcripts, e.g. by Northern blotting analysis, compared with the amount of R1 transcripts of wild-type plants.

    Moreover, in connection with the present invention, R1 gene expression can be determined by measuring the amount of R1 protein, e.g. by Western blotting analysis. The amount of R1 protein is preferably determined by means of protein extracts which are isolated from plant cells of endosperm.

    In a further embodiment of the invention, the plants according to the invention exhibit R1 gene expression in the starch-storing organs of said plants, which is increased compared with R1 gene expression in starch-storing organs of corresponding non-genetically modified wild-type-plants, preferably by at least 50%, most preferably by at least 100%, particularly by at least 250% and most particularly by at least 500%.

    In one most preferred embodiment, the plants according to the invention exhibit a organ-specific expression of the extraneous nucleic acid molecule in the starch-storing organs of the plants according to the invention.

    In the sense of the present invention, the term "organ-specific" is to be understood to mean that the selected promoter favours expression of the extraneous nucleic acid molecule in the starch-storing organs compared with mature leaves, and results in significantly increased degree of expression, such as a level of expression which is increased at least 2- to 5 times, preferably 5- to 10 times, most preferably 10- to 100 times.

    In this embodiment of the invention, the plants according to the invention are distinguished in that due to the organ-specific expression of the extraneous nucleic acid molecule they exhibit increased R1 gene expression in the starch-storing organs compared with the gene expression of the endogeneous R1 gene in the starch-storing organs of a corresponding non-genetically modified wild-type-plant. In this embodiment of the invention, an increase in R1 gene expression in the leaves of the plants according to the invention cannot be detected to the same extent as that in the starch-storing organs. The increase in R1 gene expression is preferably related solely to the starch-storing organs.

    In a preferred embodiment of the invention, the plants according to the invention are plants from the group consisting of wheat, rice, barley, millet, oats, rye and maize. Wheat, rice and maize plants are preferred; wheat plants are particularly preferred.

    The invention also relates to a method of producing a plant as defined according to the invention, wherein (a) a cell of a monocotyledon plant is genetically modified, wherein the genetic modification consists of the introduction of at least one extraneous nucleic acid molecule; (b) a plant is regenerated from the cell according to step (a); and optionally (c) further plants are produced from the plant produced according to step (b).

    The present invention further relates to a method of producing a plant as defined according to the invention, which in the starch-storing organs of said plant synthesises a starch with an increased phosphate content and/or a modified phosphorylation pattern and/or an increased final viscosity and/or a reduced peak temperature compared with starch from starch-storing organs of wild-type-plants, wherein (a) a cell of a monocotyledon plant is genetically modified, wherein the genetic modification consists of the introduction of at least one extraneous nucleic acid molecule as defined according to the invention; (b) a plant is regenerated from the cell according to step (a); and optionally (c) further plants are produced from the plant produced according to step (b).

    The same applies to the genetic modification which is introduced according to step (a) as that which has already been explained above in connection with the plant cells and plants according to the invention.

    The regeneration of plants according to step (b) can be accomplished by methods known to one skilled in the art.

    The production of further plants according to step (c) of the method according to the invention can be accomplished, for example, by vegetative propagation) e.g. via cuttings, tubers or via callus cultivation and the regeneration of whole plants) or by sexual propagation. Sexual propagation preferably occurs in a controlled manner, i.e. selected plants with defined properties are crossed and propagated with each other.

    In one preferred embodiment of the invention, the methods according to the invention are distinguished in that the extraneous nucleic acid molecule which is introduced into the plant cell according to step (a) is selected from the group consisting of: (i) nucleic acid molecules which comprise the coding region of the nucleotide sequence represented in Seq ID No. 1; (ii) nucleic acid molecules which encode an R1 protein from Solanum tuberosum with the amino acid sequence given in Seq ID No. 2; (iii) nucleic acid molecules which constitute a derivative of the nucleotide sequence given in Seq ID No. 1; and (iv) nucleic acid molecules which constitute fragments of the nucleic acid molecules cited in (i), (ii) or (iii).

    In one particularly preferred embodiment, the methods according to the invention are distinguished in that the extraneous nucleic acid molecule is under the control of a promoter, preferably an endosperm-specific and/or caryopsis-specific promoter, which organ-specifically facilitates R1 gene expression in starch-storing tissue.

    Promoters of this type, such as endosperm-specific and caryopsis-specific promoters, have been exemplified above in connection with the plants according to the invention.

    In a further embodiment, the methods according to the invention relate to useful monocotyledon plants, e.g. rye, barley, oats, wheat, millet, rice and maize. Wheat, rice and maize are preferred; wheat is particularly preferred.

    The present invention also relates to the plants which can be obtained by the method according to the invention.

    The present invention also relates to propagation material for plants containing plant cells according to the invention, and to the plants produced by the method according to the invention. In the sense of the present invention, the term "propagation material" comprises any constituents of the plant which are suitable for production or propagation by a vegetative or generative route. Cuttings, callus cultures, rhizomes or tubers are suitable for vegetative propagation, for example. Other propagation material comprises fruit, seeds, seedlings, protoplasts, cell cultures etc., for example. Seeds are the preferred propagation material.

    In one preferred embodiment, the present invention relates to maize grains.

    In a most preferred embodiment, the present invention relates to wheat grains.

    The maize and wheat grains according to the invention are particularly suitable for the production of fodder and of food products.

    The present invention further relates to the use of extraneous nucleic acid molecules as defined according to the invention for the production of plants according to the invention, preferably of wheat, maize and rice plants, most preferably wheat plants, or for the production of monocotyledon plant cells according to the invention.

    The plant cells and plant according to the invention synthesise, particularly in their starch-storing organs, a starch, the physicochemical properties of which, particularly the phosphate content of and/or the viscosity behaviour of which and/or the phosphorylation pattern of which is modified compared with that of starch synthesised in wild-type-plants and compared with chemically phosphorylated starches.

    Therefore, the present invention also relates to starch which can be obtained from the plant cells, plants and/or propagation material according to the invention.

    In one preferred embodiment of the invention, the starches according to the invention are characterised in that they have an increased phosphate content in the C6 position of the glucose monomer and/or a modified phosphorylation pattern and/or an increased final viscosity and/or a reduced peak temperature compared with starch from corresponding non-genetically modified wild-type plants.

    The present invention also relates starch which is characterised in that it has an increased phosphate content in the C6 position of the glucose monomer and/or a modified phosphorylation pattern and/or an increased final viscosity and/or a reduced peak temperature compared with starch from corresponding non-genetically modified wild-type plants.

    The statements made in connection with the plant cells according to the invention are applicable with regard to the increase of the phosphate content in the C6 position, the modification of the phosphorylation pattern and the modification of the viscosity properties (final viscosity, peak temperature).

    In a further embodiment, the invention relates to starches, preferably wheat starches, which are characterised in that in the C6 position of the glucose monomer they have a phosphate content of at least 0.1 nmol C6 P mg.sup.-1 starch, particularly at least 0.5 nmol C6 P mg.sup.-1 starch, preferably at least 1 nmol C6 P mg.sup.-1 starch, most preferably at least 2 nmol C6 P mg.sup.-1 starch, most particularly at least 5 nmol C6 P mg.sup.-1 starch, quite most preferably at least 10 nmol C6 P mg.sup.-1 starch and/or an increased final viscosity and/or a reduced peak temperature, wherein in the C6 position of the glucose monomer the starch according to the invention has a phosphate content of 100 nmol C6 P mg.sup.-1 starch at most, particularly 50 nmol C6 P mg.sup.-1 starch at most, or 25 nmol C6 P mg.sup.-1 starch at most.

    In a further embodiment of the invention, the starches according to the invention can be characterised in that in the C6 position of the glucose monomer they have a phosphate content of at least 15 nmol C6 P mg.sup.-1 starch, wherein in the C6 position of the glucose monomer the starch according to the invention has a phosphate content of 100 nmol C6 P mg.sup.-1 starch at most, particularly 50 nmol C6 P mg.sup.-1 starch at most, or 25 nmol C6 P mg.sup.-1 starch at most.

    In a further preferred embodiment, the starches according to the invention, preferably wheat starches, are characterised in that after conglutination the starches according to the invention form gels which exhibit an increased gel strength compared with gels of corresponding chemically phosphorylated starches of the same phosphate content and/or compared with gels of starches from corresponding non-genetically modified plants.

    In a further preferred embodiment of the invention, the starches according to the invention can be characterised in that the major part of the phosphate groups are bonded to the amylopectin component of the starch, whilst the amylose only has a very low content of covalently bonded starch monophosphate esters. Compared with chemically phosphorylated starches of comparable C-6 phosphate content, the starches according to the invention from the plant cells according to the invention are distinguished in that the amylose of the starches according to the invention is less strongly phosphorylated than is the amylopectin component.

    In a further embodiment of the invention, the starches according to the invention can be characterised in that the amylose component of said starch has a reduced total phosphate content in the amylose component compared with the amylose component of chemically phosphorylated starch, which preferably has the same phosphate content in the C6 position of the glucose monomer.

    Methods of determining of the total phosphate content are known to one skilled in the art and are described below (see methods).

    In a further embodiment the invention, the starch according to the invention can be characterised in that the total phosphate content, which can be detected by 31P NMR (Kasemsuwan and Jane (Cereal Chemistry 73 (6), (1996), 702-707) of the amylose component of said starch is reduced by at least 5%, preferably by at least 20%, particularly by at least 50% and most preferably by at least 80%, compared with the amylose component of chemically-phosphorylated starch with the same phosphate content in the C6 position of the glucose monomer which is produced from starch of corresponding non-genetically modified plants.

    In one preferred embodiment of the invention, the starches according to the invention can be characterised in that they exhibit a modified phosphorylation pattern compared with chemically phosphorylated starches.

    The term "modified phosphorylation pattern" has already been defined in connection with the plant cells according to the invention.

    In one preferred embodiment of the invention, the starches are starches from useful monocotyledon plants, such as rye-, barley, oats, wheat, millet, rice and maize starch. Wheat, rice and maize starch are preferred; wheat starch is particularly preferred.

    The present invention further relates to a method of producing the starch according to the invention, comprising the steps of extracting the starch from a plant or plant cell as described above and/or from starch-storing parts of plant such as this and/or from the propagation material according to the invention. A method such as this also preferably comprises the step of harvesting the cultivated plants and/or starch-storing pars of said plants before the extraction of the starch, and most preferably further comprises the step of cultivating plants according to the invention and/or of propagation materials according to the invention before harvesting. Methods of extracting starch from plants or from starch-storing parts of plants are known to one skilled in the art. Methods of extracting starch from various starch-storing plants are also described, for example, in Starch: Chemistry and Technology (edited by: Whistler, BeMiller and Paschall (1994), 2nd Edition, Academic Press Inc. London Ltd; ISBN 0-12-746270-8; see Chapter XII, pages 412-468, for example: Maize and sorghum starches: production; by Watson; Chapter XIII, pages 469-479: Tapioca, arrowroot and sago starches: production; by Corbishley and Miller; Chapter XIV, pages 479-490: Potato starch: production and uses; by Mitch; Chapter XV, pages 491 to 506: Wheat starch: production, modification and uses; by Knight and Oson; and Chapter XVI, pages 507 to 528: Rice starch: production and uses; by Rohmer and Klem; and see Maize starch: Eckhoff et al., Cereal Chem. 73 (1996) 54-57. The extraction of maize starch -on an industrial scale is generally effected by what is termed "wet milling"). Apparatuses which are customarily used for methods of extracting starch from plant material include mills, separators, decanters, hydrocyclones, spray driers and fluidised-bed driers.

    The present invention also relates to starch according to the invention which can be obtained by the methods according to the invention which were described above.

    The starches according to the invention can be subsequently modified by methods known to one skilled in the art, and in their unmodified or modified form are suitable for various uses in the food or non-food sectors.

    Therefore, the present invention also relates to starches as defined according to the invention which have been subsequently chemically and/or physically modified.

    Various options which can be used for chemical and/or physical modification are described in detail below.

    The production of modified starches by means of genetic engineering operations on a plant can firstly modify the properties of the starch obtained from the plant so that further modification by means of chemical or physical methods no longer appear to be necessary. Secondly, starches which have been modified by genetic engineering methods can be subjected to further chemical and/or physical modifications, which results in additional improvements in quality for some of the areas of use described above. These chemical and physical modifications are known in principle. In particular, they comprise modifications by means of: heat treatment, treatment with acids, production of starch ethers, starch alkyl ethers, O-allyl ethers, hydroxylalkyl ethers, O-carboxylmethyl ethers, N-containing starch ethers, P containing starch ethers, S-containing starch ethers, production of crosslinked starches, production of starch graft polymers, oxidation, and esterification operations which are used for the production of phosphate, nitrate, sulphate, xanthate, acetate and citrate starches. Other organic acids can also be used for esterification.

    In a further embodiment, the present invention relates to the use of the starches according to the invention in industry, preferably for the production of foodstuffs.

    In a further embodiment, the invention relates to wheat flour which contains the starches according to the invention. Amongst its other properties, the wheat flour according to the invention is distinguished by modified baking properties compared with conventional wheat flours. Methods of producing wheat flour from wheat grains are known to one skilled in the art. By means of these methods, the wheat flour according to the invention can be isolated from the plant cells and plants according to the invention and from the propagation material according to the invention.

    Thus the present invention also relates to wheat flour which can be obtained from the plant cells and plants according to the invention and from the propagation material according to the invention.

    Compared with flours from corresponding non-genetically modified wild-type plants, the flours according to the invention are distinguished in particular by their enhanced water absorption capacity. Methods of determining water absorption capacity are known to one skilled in the art and are described in detail below (see methods).

    In one preferred embodiment of the invention, the wheat flours exhibit a water absorption capacity which is increased by at least 5%, particularly by at least 15%, preferably by at least 20% and most preferably by at least 25% compared with wheat flours from corresponding non-genetically modified wheat plants.

    Due to their high water absorption capacity, the flours according to the invention have the advantage for the industrial production of dough that less water has to be supplied to the flour during the dough preparation stage.

    In a further embodiment, the present invention relates to the use of the wheat flour according to the invention and/or of the starch according to the invention for the production of a baking mixture and/or for the production of a food product.

    In a further embodiment, the present invention relates the use of the wheat flour according to the invention and/or of the starch according to the invention for the coating of packages.

    In a particularly preferred embodiment, the present invention relates to a baking mixture which contains the wheat flour according to the invention and/or the starch according to the invention. In this connection, the term "baking mixture" is to be understood to mean any mixture which can be used for the production of dough (e.g. yeast dough, pasta dough, shortcrust pastry, sour dough etc.) and/or of bakery products (e.g. bread, cakes, rolls, croissants, etc.).

    In a further particularly preferred embodiment, the present invention relates to a food product, preferably bakery and dough products (e.g. pasta) which is produced using the wheat flour according to the invention and/or the baking mixture according to the invention and/or the starch according to the invention.

    Compared with bakery products which are produced from wheat flours from corresponding non-genetically modified wheat wild-type wheat plants, the bakery products and/or food products according to the invention are distinguished on storage by a slowing down of the ageing process which the bakery products undergo.

    The ageing process of a bakery product is closely linked to the degree of retrogradation (recrystallisation) of the amylopectin component of the starch. It is assumed that the ageing process of a bakery product and/or food product has progressed further, the higher is the degree of retrogradation of the amylopectin component The enthalpies of fusion of the amylopectin which can be determined by DSC provide information on the degree of retrogradation of the amylopectin. The degree of ageing of a bakery product can thus be determined by determining the enthalpy of fusion of the amylopectin at a given point in time by means of DSC (=differential scanning calorimetry) analysis (see methods).

    If the enthalpy of fusion of the amylopectin of the bakery products and/or food products according to the invention is determined after storage for three and/or seven and/or thirteen days, for example, it is found that the enthalpy of fusion of the amylopectin is reduced compared with the enthalpy of fusion of the amylopectin of bakery products and/or food products which are stored for the same length of time and which are based on wheat flours of corresponding non-genetically modified wild-type plants. This shows that the bakery products and food products according to the invention are distinguished by a slower ageing process compared with conventional products.

    The Figures are as follows:

    FIG. 1: is a schematic illustration of an RVA profile;

    FIG. 2: is a plasmid map of the vector pUbi2afp

    FIG. 3: is a plasmid map of the vector pUbiR1

    FIG. 4: is a plasmid map of the vector p35SAcS (a derivative of pUC18 (Pietrzak M. et al., Nucleic Acids Res. 14, (1986), 5857-5868): contains the pat gene from Streptomyces viridochromogenes (Wohlleben et al., Gene 70, (1988), 25-37) under the control of the CaMV35S promoter.

    FIG. 5: is a plasmid map of the vector pAct1-Fneo/Calgus (pUC19-derivative (Yannish-Perron et al., 1985, Gene 33: 103-119): formed from pAct1-Fneo (Muller et al., Plant Science 114, (1996), 71-82) and pCalgus, which contains the CaMV35S promoter (see U.S. Pat. No. 5,352,605, for example), the Adhl intron from maize (Genes Dev 1987 December; 1(10):1183-200) and the beta-glucuronidase (GUS) gene (The GUS Reporter System as a Tool to Study Plant Gene expression in: GUS Protocols: Using the GUS Gene as a Reporter of Gene expression, Academic Press (1992), 23-43).

    FIG. 6: shows the enthalpy of breadcrumbs during storage after 1, 3, 7 and 13 days.

    METHODS

    Determination of the Phosphate Content in the C6 Position of the Glucose Monomer (.dbd.C6 P Content) of the Starch (Nielsen et al. Plant Physiol. 105, (1994), 111-117):

    In order to determine the C6 P content of the starch, 50 mg starch were hydrolysed in 500 .mu.l 0.7 M HCl for 4 hours at 95.degree. C. The batches were subsequently centrifuged for 10 min at 15500g and the supernatants were taken off. 7 .mu.l of the supernatants were mixed with 193 .mu.l imidazole buffer (100 mM imidazole, pH 7.4; 5 mM MgCl.sub.2, 1 mM EDTA and 0.4 mM NAD). Measurements were made in a photometer at 340 nm. After establishing the base absorption, the enzyme reaction was initiated by adding 2U glucose-6-phosphate dehydrogenase (from Leuconostoc mesenteroides, Boehringer Mannheim). The change in absorption was directly proportional to the concentration of the C6 P content of the starch.

    Determination of the Total Phosphate Content of the Starch:

    Before determining the total phosphate content of the starch, the starch had to be completely separated from phosphorylated non-glucans such as phospholipids. The Determination of the total phosphate content was determined by the method of Ames (Methods in Enzymology VIII, (1966), 115-118), as follows:

    About 50 mg starch were treated with 30 .mu.l of 10% ethanolic magnesium nitrate solution and were ignited for three hours in a muffle furnace. The residue was treated with 500 .mu.l 0.5 M hydrochloric acid and incubated for 30 min at 60.degree. C. A 20 .mu.l aliquot was then made up to 300 .mu.l with 0.5 M hydrochloric acid, was added to a mixture of 100 .mu.l of 10% ascorbic acid and 600 .mu.l of 0.42% ammonium molybdate in 1 M sulphuric acid, and was incubated for 20 min at 45.degree. C. This was followed by a photometric determination at 820 nm using a phosphate calibration series as a standard.

    Determination of the Gel Strength (Texture Analyser):

    2.5 g starch (TS) were conglutinated in 25 ml H.sub.2O in an RVA instrument (see determination of the viscosity properties by means of a Rapid Visco Analyzer (RVA)) and were subsequently stored for 24 hours at room temperature. The samples were fixed under the sensor (a cylindrical plunger with a planar surface) of a TA-XT2 texture analysers supplied by Stable Micro Systems (Surrey, UK) and the gel strength was determined using the following instrument settings:

    TABLE-US-00002 Test speed 0.5 mm/s Depth of penetration 7 mm Contact area 113 mm.sup.2 Pressure 2 g

    Determination of the Viscosity Properties (e.g. Final Viscosity) by Means of a Rapid Visco Analyzer (RVA):

    2.5 g starch (dry weight) were taken up in 25 ml H.sub.2O and used for analysis in a Rapid Visco Analyzer (Newport Scientific Pty Ltd., Investment Support Group, Warriewod NSW 2102, Australia). The instrument was operated according to the manufacturer's instructions. In order to determine the viscosity of the aqueous solution of the starch, the starch suspension was first heated for one minute to a temperature of 50.degree. C. and was then heated from 50.degree. C. to 95.degree. C. at a rate of 12.degree. C. per minute. The temperature was subsequently held for 2.5 minutes at 95.degree. C. Thereafter, the solution was cooled from 95.degree. C. to 50.degree. C. at a rate of 12.degree. C. per minute. Finally, the temperature was held for a further 6 minutes at 50.degree. C. The viscosity was determined over the entire duration of the test.

    Isolation of the Amylose Component of the Starch by Aqueous Leaching:

    It is known that amylose can be obtained from starch by aqueous leaching (Roger and Colonna (International Journal of Biological Macromolecules 19, (1996), 51-61). In order to isolate the amylose component of the starch, 25 ml of an aqueous starch suspension (10% w/v) were prepared and heated in an RVA (Newport Scientific) with stirring, using the following profile:

    TABLE-US-00003 Time Value [.degree. C.] or [min] Type [rpm] 0 Temp 30.degree. 0 Speed 960 rpm 0.5 Speed 300 rpm 10 Temp 95.degree.

    Directly after the viscosity of the suspension or solution exceeded 200 cP, the programme was terminated and the starch suspension or solution was transferred into a cold, 50 ml reaction vessel, mixed with 25 ml of cold water and cooled for 10 min in an ice bath to about room temperature (RT). Thereafter, the undissolved glucan was formed into a pellet by centrifugation (20 min at 2300g at RT) and the clear supernatant was treated with 10 mg NaCl/ml. The dissolved glucan was then precipitated on to ice from 80% ethanol, was washed with ethanol again, and was dried for 3 days at 37.degree. C. The pellet was subsequently ground (15 s 30 Hz with tungsten carbide balls in a in a vibrating mill supplied by Retsch, Germany), and 25 mg of the pellet was suspended in 500 .mu.l of 0.7 M HCl hydrolysed at 95.degree. C. for 4 hours. Undissolved particles were then removed by centrifugation and the content of glucose-6P was determined enzymatically (see above: "Determination of the phosphate content in the C6 position of the glucose monomer").

    Procedure for the Small Scale Water Absorption Test on Wheat Flour:

    Materials

    Eppendorf cups (2 ml) with screw cap from Sarsted.

    Eppendorf centrifuge (Sigma 202)

    Vortex (Wilten)

    Analytical Balance (Mettler)

    Method

    Measure the weight of the epp.cup to four decimal places using the analytical balance.

    Fill the cup with 100 to 110 mg flour and note the exact weight.

    Put the cup with flour on the vortex and add 1.0 ml water during vortexing.

    Keep on vortexing for 10 seconds.

    Add 0.9 ml water and close the cup with the screw cap.

    Wait ten minutes.

    Put the cups in the 6*10 rotor (swing out) in the centrifuge.

    Run the centrifuge for 30 minutes at 10,000 rpm (about 8600*g).

    Pour off the water from the cup.

    Dry the inside of the cup with filter paper without disturbing the wet residue.

    Measure the weight of the Eppendorf cup with the wet flour to four decimal places using the analytical balance.

    Calculate the weight of the absorbed water.

    Determine the waterabsorption of each flour ten times and calculate the average.

    Differential Scanning Calorimetry:

    Differential Scanning Calorimetry (DSC) is a technique studying thermal transitions, in this case of breadcrumbs.

    With this technique the heat flow into a sample is determined at a continuous (relatively low) heating rate. Either a peak (offset from the base line (endotherm)) or a step in the base line (glass transition) determines transitions. Integration of the peak area with respect to the base line gives the enthalpy of the transition. For breadcrumbs, an amylopectin heat of fusion between 40 and 70.degree. C. (60.degree. C. peak) and an amylose-lipid decomplexation at about 120.degree. C. are generally observed.

    Differences in the heat of fusion of amylopectin between the various flour samples indicate differences in retrogradation behaviour, and hence indicate that the bread is becoming stale. The enthalpy of fusion of the amylopectin crystals increases with storage time after baking. An increase in the enthalpy of fusion during storage is a measure of an increase in the amount of recrystallised amylopectin with time. The enthalpies 0/g) were calculated on a dry matter basis in order to correct for differences in moisture content.

    DSC measurements were made using a TA Instruments Type 2920 calorimeter with LNCA cooling unit. This cooling unit uses liquid nitrogen for fast cooling after the experiment.

    Samples (40-50 mg breadcrumbs) were placed in a DSC pan and compressed by hand with a nail. After sealing the DSC pan with a compression unit the sample was placed in the DSC-apparatus.

    Samples (40-50 mg breadcrumbs) were heated from 20.degree. C. to 160.degree. C. at a rate of 7.5 C/min in stainless steel hermetically sealed pans (Perkin Elmer). A medium pressure pan (120 .mu.l volume), filled with 100 mg aluminium, was used as a reference.

    The enthalpies of the crumbs of the mini-loaves were measured after 1, 3, 7 and 14 days of storage in single measurements.

    The following examples serve to explain the invention without limiting it in any respect:

    EXAMPLE 1

    Production of Vector pUbiR1 for the Transformation of Wheat Plants

    In order to produce vector pUbiR1, vector pUbi.cas was first produced as follows: Vector pUbi2afp (see FIG. 2) was partially cut with restriction enzymes PstII/EcoRI. The 4.19 Kb fragment which resulted therefrom, consisting of the pUC19 vector (Yannish-Perron et al., 1985, Gene 33: 103-119), the 1.5 Kb ubiquitin promoter and of the first exon of the ubi gene and a shortened ubiquitin1 intron (ClaI deletion) (Christensen et al., Plant Mol. Biol. 18, (1992), 675-689) was used further after gel elution.

    The nos terminator was isolated as a PstI/EcoRI fragment from the vector pAct.cas (Product Number Cambia TG0063, supplied by Cambia, GPO Box 3200, Canberra ACT 2601, Australia) and ligation of the two fragments was effected to give the vector pUbi.cas.

    The cDNA of the potato R1 gene (SEQ ID No. 1) was subsequently isolated as a partial digest (SmaI/Asp718 fragment) from the vector pRL2 (WO97/11188, Example 4, deposited at the German Collection for Microorganisms with the number DSM 10225) and was integrated in the vector pUbi.cas (restriction with SmaI/Asp718). The resulting construct was designated as pUbiR1 (see FIG. 3). This construct comprises the coding region of the R1 cDNA from potatoes, which is under the control of the ubiquitin promoter (Christensen et al., 1992, Plant Mol. Biol. 18: 675-689), and also comprises, as additional regulation units, the first exon of the ubi gene (Christensen et al., Plant Mol. Biol. 18, (1992), 675-689) and the shortened first intron (Christensen et al., Plant Mol. Biol. 18, (1992), 675-689), the internal ClaI fragment being deleted).

    EXAMPLE 2

    Production of Wheat Plants which Express an R1 Gene from Solenum tuberosum, and Analysis of the Phosphate Content of the Starch of these Plants

    The biolistic transformation method was used for the transformation of wheat (Becker et al., Plant J. 5 (2), (1994), 229-307). The vector pUbiR1 and, for biolistic cotransformation, the vectors p35SAcS (see FIG. 4) or pAct1-Fneo/Calgus (Muller et al., Plant Science 114, (1996), 71-82, see FIG. 5) were used in identical molar ratios in the DNA particle precipitation batch.

    Vector p35SAcS was produced as follows: The pat gene from S. viridochromogenes (Wohlleben et al., Gene 70, (1988), 25-37) was amplified via a polymerase chain reaction. The primers used were designed so that a BamHI cleavage site was created on both sides of the amplificate. The BamHI fragment was subsequently cloned into the BamHI cleavage site placed between the 35S promoter and the 35S terminator of the vector pDH51 (Pietzrak et al., Nucleic Acids Res. 14, (1986), 5857-5868). The cassette containing the 35S promoter, the pat gene and the 35S terminator was cut as an EcoRI fragment and was cloned into in the EcoRI cleavage site of the vector pUC18 (Pietzrak et al., Nucleic Acids Res. 14, (1986), 5857-5868). Scutelli from 14-day old, unripe embryos of wheat plants were used as target cells for transformation. Transformation was followed by in vitro culture on MS.sup.- medium (PCT/EP97/02793) containing 2 mg/l 2,4-D (=2,4-dichlorophenoxyacetic acid). Two weeks after transformation, subculture was effected on the same medium, to which 2 mg/l phosphinotricin or 150 mg/l kanamycin sulphate had been added. After a further two weeks, the developing calli were transplanted on to a regeneration medium (MS.sup.- medium with 0.1 mg/l 2,4-D and 2 mg/l PPT or 150 mg/l kanamycin). The developing shoots were transferred to semi-concentrated MS.sup.- medium without 2,4-D and phosphinotricin or kanamycin and were subsequently transferred into the ground. About 14 days after their establishment in the ground, the transgenic plants were identified by spraying twice with an aqueous solution containing 150 and 200 mg/l phosphinotricin, respectively, 0.1% Tween 20 (ICI America, corresponding to polysorbate 20) or by spraying twice with 2.5% kanamycin sulphate, 0.1% Tween 20.

    Expression of the Potato R1 Gene in T.sub.0 Slants

    Expression of the potato R1 gene in transgenic wheat T.sub.0 plants was detected by Northern and Western blotting analyses and by the enzymatic determination of the phosphate content in the C6 position of the glucose monomer of the starch from caryopses (Nielsen et al., Plant Physiol. 105, (1994), 111-117).

    R1 protein was detected in the transgenic wheat plants with the aid of an anti-potato

    R1 protein antibody (Ritte et al., Plant J. 21(4), (2000), 387-391).

    Protein extracts from the endosperm of unripe caryopses about 20 days old was used for screening the transgenic plants.

    Starch from transgenic T.sub.0 plants was isolated from unripe and ripe wheat caryopses in order to determine C6 phosphate. The caryopses were triturated in a mortar to form a powder. After adding 15 ml of 100 mM Tris buffer, pH 8.0, the suspension was filtered through a 100 .mu.m sieve and the starch was pelletised by centrifugation (2600 g, 5 min, 4.degree. C.). The supernatant was discarded. The starch pellet was subsequently re-suspended in 2 ml of 100 mM Tris buffer, pH 8.0 and transferred to an 8 ml Percoll gradient. The starch was palletised by centrifugation for 15 minutes at 170 g and 4.degree. C. The starch pellet was subsequently washed three times with 10 ml of 100 Tris buffer, pH 8.0. Finally, the starch was degreased by acetone incubation and was dried.

    The C6 P content was determined by glucose-6-phosphate determination by means of an optical-enzymatic test (Nielsen et al., Plant Physiol. 105, (1994), 111-117) in the manner described above.

    The tests showed that of the wheat T.sub.0 plants which gave a positive result in Southern blotting analysis about 50% of the lines in the caryopses synthesised a starch which had an increased phosphate content in the C6 position of the glucose monomer compared with starch from corresponding non-genetically modified wild-type-plants of the Florida variety. Table 1 gives the data for some selected lines.

    Analysis of Natural Descendants

    Seeds which were obtained naturally from R1-expressing parental lines was sown and the segregation ratios were determined. It was possible to detect both the integration and also the expression of the R1 gene in T.sub.1 descendants of different lines by Southern and Northern blotting analyses. The phosphate content of these lines in the C6 position of the starch was determined. Table 1 shows the data for some selected lines.

    TABLE-US-00004 TABLE 1 Standard Line No. C6 P in nmol/mg Generation deviation Wild-type Florida variety Not detectable -- 0.0 19 2.8 T0 0.2 20-25 6.7 T1 0.2 37 1.4 T0 0.3 40A-11-8 10.7 T2 0.7

    EXAMPLE 3

    RVA Analysis of the Starch of Plants from Transgenic Wheat Plants which Express an R1 Gene from Solanum tuberosum, and Investigation of the Gel Strength

    The starches from the wheat plants described in Examples 1 and 2 were subjected to an RVA analysis.

    The results of the RVA analysis (experimental: see methods) showed that the viscosity behaviour of the starches from the transgenic wheat plants which express an R1 gene from Solanum tuberosum is significantly modified compared with starches from corresponding non-genetically modified wild-type-wheat plants (Florida variety) (see Table 2).

    TABLE-US-00005 TABLE 2 RVA RVA RVA RVA Max Min Fin Set RVA T Line No. (%) (%) (%) (%) (%) Wild-type 100 100 100 100 100 (Florida) 19 (T0) 98.7 113.8 116.8 120.7 102 20-25 (T1) 155.3 190 193.8 198.8 99 37 (T0) 143.8 156.2 148.8 139 101 40-11-8 (T2) 156.2 185.5 187.7 190.6 97 Legend: RVA = Rapid Visco Analyzer Max = see FIG. 1 Min = see FIG. 1 Fin = final viscosity, see FIG. 1 Set = Setback = Difference between Min and Fin, see FIG. 1 T = Conglutination temperature, see FIG. 1 The percentages are given with respect to the wild-type (=100%).

    The gel strengths of the starches (determination of the gel strength: see methods) from the transgenic wheat plants which express an R1 gene from Solanum tuberosum differed both from those of starches from corresponding non-genetically modified wild-type-wheat plants (Florida variety) and from those of wild-type-starches (Florida variety), which had subsequently been chemically phosphorylated (see Table 3).

    In contrast to chemically phosphorylated starches with a comparable phosphate content in the C6 position of the glucose monomer, after conglutination the gels of the starches according to the invention exhibited an increased gel strength compared with gels of starches of wild-type-plants. In contrast to this, the chemically phosphorylated starches which had been produced by the method described by Lim compared with gels of starches of wild-type plants.

    TABLE-US-00006 TABLE 3 Gel strength Phosphate content in the (TA) C6 position in .mu.mol Line No. (%) phosphate/g starch Wild-type (Florida) 100 Not detectable 19 (T0) 167 2.8 20-25 (T1) 192 6.7 37 (T0) 168 1.4 40-11-8 (T2) 224 10.7 Chemically phosphorylated wild-type (Florida) starch STMP1 84 2.1 STMP6 75 6.5 STMP8 67 11.5 TA = texture analyzer The percentages are given with respect to the wild-type (= 100%).

    EXAMPLE 4

    DSC Analysis of the Starch of Plants from Transgenic Wheat Plants which Express an R1 Gene from Solanum tuberosum

    The starches from the wheat plants described in Examples 1 and 2 were subjected to DSC analysis.

    The peak temperature was determined using an instrument supplied by Perkin Elmer (instrument designation: DSC-7) using large volume capsules, wherein the sample to be investigated had a ratio of starch to total water content of about 1:4 and measurements were made over the temperature range from 10.degree. C. to 160.degree. C. at a heating rate of 10.degree. C./min.

    The results of the DSC analysis (Table 4) show that the peak temperature of the starches from the transgenic wheat plants which express an R1 gene from Solanum tuberosum exhibit a reduced peak temperature Tp compared with starches from corresponding non-genetically modified wild-type-wheat plants (Florida variety) and also compared with starches of comparable phosphate content in the C6 position of the glucose monomer which were subsequently chemically phosphorylated.

    TABLE-US-00007 TABLE 4 Peak Water temperature Other content of Starch in .degree. C. peak sample (dry weight):water (first peak maxima in Sample (%) (total water content) maximum) .degree. C. Wild-type 16.6 1:4.01 61 101 (Florida) 19 (T0) 10.5 1:3.99 58 100 20-25 (T1) 16.9 1:4.05 55 100 40-11-8 (T2) 16.9 1:3.98 56 100 STMP2* 10.9 1:4.00 60 101 STMP6 10.7 1:4.00 61 101 *The chemically phosphorylated starch STMP2 had a phosphate content in the C6 position of 3.0 .mu.mol phosphate/g starch. All the other phosphate data are given in Table 3.

    EXAMPLE 5

    Determination of the C6 P Content of the Amylose Component of Various Starches

    Apart from starch from transgenic wheat plants which express an R1 gene from Solanum tuberosum, two chemically phosphorylated starches (STMP3 and STPP4) were investigated. Chemical phosphorylation was effected by the method described by Lim and Seib (Cereal Chem. 70 (2), (1993), 137-144), wherein STMP3 was produced by reacting the starch for 2 hours at pH 6, and STPP4 was produced by reaction for 30 minutes at pH 8. The abbreviation STMP represents the selected phosphorylation reagent, namely sodium trimetaphosphate; STPP represents sodium tripolyphosphate.

    The amylose component of various starches was isolated as described above (isolation of the amylose component of the starch by aqueous leaching). The phosphate content in the C6 position was determined as described above (determination of the phosphate content in the C6 position of the glucose monomer).

    TABLE-US-00008 TABLE 5 C6 P content in C6 P content in .mu.mol C6 P content of .mu.mol phosphate/ amylose/C6 P Sample phosphate/g starch g amylose content of starch 40-11-8 (T2) 10.7 1.9 0.18 STPP4 20.5 20.4 0.99 STMP3 6.0 5.1 0.85

    It can be seen that the ratio of the C6 P content of the amylose to the C6 P content of the starch in the chemically phosphorylated starches is considerably higher than in the starches from the transgenic wheat plants which superexpress an R1 Gen from potatoes. The chemically phosphorylated starches have a higher content of phosphorylated amylose than do the starches from the transgenic wheat plants.

    EXAMPLE 6

    DSC Analysis of Breadcrumbs from Micro-Loaves Produced from Flour of Different Origins

    Wheat flour from wheat wild-type plants (Florida variety) and from genetically modified wheat plants which superexpress the R1 gene from potato was used to produce micro-loaves, using the following recipe:

    TABLE-US-00009 Wheat flour 10.00 g Yeast 0.25 g Salt 0.20 g Dextrose 0.10 g Ascorbic acid 20 ppm Water the amount of water as determined in the water absorption test and corrected for consistency (see method "Procedure for small scale water absorption test on wheat flour")

    The dough of the genetically modified wheat plants became very sticky during the mixing process. To obtain doughs with correct handling properties a smaller amount of water was used. The dough consistency was corrected by technical sensory perception of the stiffness of the dough.

    The dough was proofed in a proofing cabinet for 45 minutes (28.degree. C.), manually worked through, proofed for 15 minutes (28.degree. C.) for a second time, formed and put in a baking tin. Subsequently, the dough was given a final proof for 60 minutes (28.degree. C.). The loaves were baked in an oven for 15 minutes (200.degree. C.), with the tins embedded in a moist wooden frame. This embedding was done to shield the baking tin from high amounts of radiative heat. Finally, the loaves were baked for 5 minutes, without the wooden frame, to allow the crust to brown.

    Differential scanning calorimetry (DSC) (see methods) was used to determine thermal transitions of the breadcrumbs. The enthalpies of crumbs from the loaves were measured after 1, 3, 7 and after 14 days of storage (FIG. 6).

    FIG. 6 shows the enthalpy of the amylopectin fusion peak (40.degree. C.-70.degree. C.) for stored bread crumbs after 1, 3, 7 and 13 days of storage, giving an indication of staling effects. The breadcrumbs from loaves made from wild-type (Florida) flour have a higher enthalpy compared with breadcrumbs of the same age made from flour from two different lines (GMO1 and GMO2) of genetically modified wheat plants which superexpress the R1 gene from potato. This indicates a lower level of recrystallised starch, less retrogradation of starch and less staling of the bread.

    Sequence Protocol:

    TABLE-US-00010 SEQ ID No. 1 (R1 cDNA potato, nucleotide sequence 5061 bp, coding region: bp 216 to bp 4607): gaattgtaatacgactcactatagggcgaattgggtaccgggccccccct cgaggtcgacggtatcgataagcttgatatcgaattcgcggccgcttttg cttcgtgaattcatcttcatcgaatttctcgacgcttcttcgctaatttc ctcgttacttcactagaaatcgacgtttctagctgaacttgagtgaatta agccagtgggaggatatgagtaattccttagggaataacttgctgtacca gggattcctaacctcaacagtgttggaacataaaagtagaatcagtcctc cttgtgttggaggcaattctttgtttcaacaacaagtgatctcgaaatca cctttatcaactgagtttcgaggtaacaggttaaaggtgcagaaaaagaa aatacctatgggaaagaaccgtgctttttctagttctcctcatgctgtac ttaccactgatacctcttctgagctagcagaaaagttcagtctagaaggg aatattgagctacaggttgatgttaggcctcccacttcaggtgatgtgtc ctttgtggattttcaagctacaaatggtagtgataaactgtttttgcact ggggggcagtaaagttcggaaaagaaacatggtctcttcctaatgatcgt ccagatgggaccaaagtgtacaagaacaaagcacttagaactccatttgt taaatctggctctaactccatcctgagactggagatacgggacactgcta tcgaagctattgagtttctcatatacgatgaagcctacgataaatggata aagaataatggtggcaattttcgtgtcaaattgtcaagaaaagagatacg aggcccagatgtttcagttcctgaggagcttgtacagatccaatcatatt tgaggtgggagaggaagggaaaacagaattacacccctgagaaagagaag gaggaatatgaggctgctcgaactgagctacaggaggaaatagctcgtgg tgcttccatacaggacattcgagcaaggctaacaaaaactaatgataaaa gtcaaagcaaagaagagcctcttcatgtaacaaagagtgaaatacctgat gaccttgcccaagcacaagcttacattaggtgggagaaagcaggaaagcc gaactatcctccagaaaagcaaattgaagaactcgaagaagcaagaagag aattgcaacttgagcttgagaaaggcattacccttgatgagttgcggaaa aagattacaaaaggggagataaaaactaaggcggaaaagcacgtgaaaag aagctcttttgccgttgaaagaatccaaagaaagaagagagactttgggc agcttattaataagtatccttccagtcctgcagtacaagtacaaaaggtc ttggaagaaccaccagccttatctaaaattaagctgtatgccaaggagaa ggaggagcagattgatgatccgatccttaataaaaagatctttaaggtcg atgatggggagctactggtactggtagcaaagtcctctgggaagacaaaa gtacatatagctacagatctgaatcagccaattactcttcactgggcatt atccaaaagtcgtggagagtggatggtaccaccttcaagcatattgcctc ctggatcaattattttagacaaggctgccgaaacacctttttccgccagt tcttctgatggtctaacttctaaggtacaatctttggatatagtaattga agatggcaattttgtggggatgccatttgttcttttgtctggtgaaaaat ggattaagaaccaagggtcggatttctatgttgacttcagtgctgcatcc aaattagcactcaaggctgctggggatggcagtggaactgcaaagtcttt actggataaaatagcagatatggaaagtgaggctcagaagtcatttatgc accggtttaatattgctgctgacttgatagaagatgccactagtgctggt gaacttggttttactggaattcttgtatggatgaggttcatggctacaag gcaactgatatggaacaaaaactataacgtaaaaccacgtgaaataagca aggctcaggacagacttacagacttgttgcagaatgctttcaccagtcac cctcaataccgtgaaattttgcggatgattatgtcaactgttggacgtgg aggtgaaggggatgtaggacagcgaattagggatgaaattttggtcatcc agaggaaaaatgactgcaagggtggtatgatggaagaatggcatcagaaa ttgcataataatactagtcctgatgatgttgtgatctgtcaggcattgat tgactacatcaagagtgattttgatcttggtgtttattggaaaaccctga atgagaacggaataacaaaagagcgtcttttgagttatgaccgtgctatc cattctgaaccgaattttagaggagatcaaaagaatggtcttttgcgtga tttaggtcactatatgagaacattgaaggctgttcattcaggtgcagatc ttgagtctgctattgcaaactgcatgggctacaaaactgagggagaaggc tttatggttggagtccagataaatcctgtatcaggcttgccatctggctt tcagggcctcctccattttgtcttagaccatgtggaagataaaaatgtgg aaactcttcttgagggattgctagaggctcgtgaggagcttaggcccttg cttctcaaaccaaacaaccgtctaaaggatctgctgtttttggacatagc acttgattctacagttagaacagcagtagaaaggggatatgaagaattga acaacgctaatcctgagaaaatcatgtacttcatctccctcgttcttgaa aatctcgcactctctgtggacgataatgaagatcttgtttattgcttgaa gggatggaatcaagctctttcaatgtccaatggtggagacaaccattggg ctttatttgcaaaagctgtacttgacagaatccgtcttgcacttgcaagc aaggcagagtggtaccatcacttattgcagccatctgccgaatatctagg atcaatccttggggtggaccaatgggctttgaacatatttactgaagaaa ttatacgtgctggatcagcagcttcattatcctctcttcttaatagactc gatcccgtgcttcggaaaactgcaaatctaggaagttggcagattatcag tccagttgaagccgttggatatgttgtcgttgtggatgagttgctttcag ttcagaatgaaatctacaagaagcccacgatcttagtagcaaactctgtt aaaggagaggaggaaattcctgatggtgctgttgccctgataacaccaga catgccagatgttctttcacatgtttctgttcgagctagaaatgggaagg tttgctttgctacatgctttgatcccaatatattggctgacctccaagca aaggaaggaaggattttgctcttaaagcctacaccttcagacataatcta tagtgaggtgaatgagattgagctccaaagttcaagtaacttggtagaag ctgaaacttcagcaacacttagattggtgaaaaagcaatttggtggttgt tacgcaatatcagcagatgaattcacaagtgaaatggttggagctaaatc acgtaatattgcatatctgaaaggaaaagtgccttcctcggtgggaattc ctacgtcagtagctcttccatttggagtctttgagaaagtactttcagac gacataaatcagggagtggcaaaagagttgcaaattctgacgaaaaaact atctgaaggagacttcagcgctcttggtgaaattcgcacaacgattttag atctttcagcaccagctcaattggtcaaagagctgaaggaaaagatgcag ggttctggcatgccttggcctggtgatgaaggtccaaagcggtgggaaca agcatggatggccataaaaaaggtgtgggcttcaaaatggaatgagagag catacttcagcacaaggaaggtgaaactggatcatgactatctgtgcatg gctgtccttgttcaagaaataataaatgctgattatgcatttgtcattca cacaaccaacccatcttccggagacgactcagaaatatatgccgaggtgg tcaggggccttggggaaacacttgttggagcttacccaggacgtgctttg agttttatctgcaagaaaaaggatctcaactctcctcaagtgttaggtta cccaagcaaaccgatcggccttttcataaaaagatctatcatcttccgat ctgattccaatggggaagatttggaaggttatgccggtgctggcctctac gacagtgtaccaatggatgaggaggaaaaagttgtaattgattactcttc cgacccattgataactgatggtaacttccgccagacaatcctgtccaaca ttgctcgtgctggacatgctatcgaggagctatatggctctcctcaagac atcgagggtgtagtgagggatggaaagatttatgtcgttcagacaagacc tcagatgtgatcatattctcgttgtatgttgttcagagaagaccatagat gtgatcatattctcatggtatcagatctgtgaccacttacctcccatgaa gttgcctgtatgattatacgtgatccaaagccatcacatcatgttcacct tcagctattggaggagaagtgagaagtaggaattgcaatatgaggaataa taagaaaaactttgtagaagttaaattagctgggtatgatatagggagaa atgtgtaaacattgtactatatatagtatacacacgcattatgtatttgc attatgcactgaataatatcgcagcatcaaagaagaaatcctttgagtgg tttcaattgccgcggccgcgaattcctgcagcccgggggatccactagtt ctagagcggccgccaccgcggtggagctccagcttttgttccctttagtg agggttaattt SEQ ID No. 2, (R1 protein from potato, amino acid sequence: 1464 amino acids) Msnslgnnllyqgfltstvlehksrisppcvggnslfqqqvisksplste frgnrlkvqkkkipMgknrafsssphavlttdtsselaekfslegnielq vdvrpptsgdvsfvdfqatngsdklflhwgavkfgketwslpndrpdgtk vyknkalrtpfvksgsnsilrleirdtaieaiefliydeaydkwiknngg nfrvklsrkeirgpdvsvpeelvqiqsylrwerkgkqnytpekekeeyea artelqeeiargasiqdirarltktndksqskeeplhvtkseipddlaqa qayirwekagkpnyppekqieeleearrelqlelekgitldelrkkitkg eiktkaekhvkrssfaveriqrkkrdfgqlinkypsspavqvqkvleepp alskiklyakekeeqiddpilnkkifkvddgellvlvakssgktkvhiat dlnqpitlhwalsksrgewMvppssilppgsiildkaaetpfsasssdgl tskvqsldiviedgnfvgMpfvllsgekwiknqgsdfyvdfsaasklalk aagdgsgtakslldkiadMeseaqksfMhrfniaadliedatsagelgft gilvwMrfMatrqliwnknynvkpreiskaqdrltdllqnaftshpqyre ilrMiMstvgrggegdvgqrirdeilviqrkndckggMMeewhqklhnnt spddvvicqalidyiksdfdlgvywktlnengitkerllsydraihsepn frgdqkngllrdlghyMrtlkavhsgadlesaiancMgyktegegfMvgv qinpvsglpsgfqgllhfvldhvedknvetllegtleareelrplllkpn nrlkdllfldialdstvrtavergyeelnnanpekiMyfislvlenlals vddnedlvyclkgwnqalsMsnggdnhwalfakavldrirlalaskaewy hhllqpsaeylgsilgvdqwalnifteeiiragsaastssllnrldpvlr ktanlgswqiispveavgyvvvvdellsvqneiykkptilvansvkgeee

    ipdgavalitpdMpdvlshvsvrarngkvcfatcfdpniladlqakegri lllkptpsdiiysevneielqsssnlveaetsatlrlvkkqfggcyaisa deftseMvgaksrnaylkgkvpssvgiptsvalpfgvfekvlsddinqgv akelqiltkklsegdfsalgeirttildlsapaqlvkelkekMqgsgMpw pgdegpkrweqawMaikkvwaskwnerayfstrkvkldhdylcMavlvqe iinadyafvihttnpssgddseiyaevvrglgetlvgaypgralsfickk kdlnspqvlgypskpiglfikrsiifrsdsngedlegyagaglydsvpMd eeekvvidyssdplitdgnfrqtilsniaraghaieelygspqdiegvvr gkiyvvqtrpqM

    >

    DNASolanum tuberosumCDS(26attgtaat acgactcact atagggcgaa ttgggtaccg ggccccccct cgaggtcgac 6gata agcttgatat cgaattcgcg gccgcttttg cttcgtgaat tcatcttcat tttctc gacgcttctt cgctaatttc ctcgttactt cactagaaat cgacgtttct gaactt gagtgaatta agccagtggg aggat atg agt aat tcc tta ggg 233 Met Ser Asn Ser Leu Gly aac ttg ctg tac cag gga ttc cta acc tca aca gtg ttg gaa cat 28n Leu Leu Tyr Gln Gly Phe Leu Thr Ser Thr Val Leu Glu His t aga atc agt cct cct tgt gtt gga ggc aat tct ttg ttt caa 329Lys Ser Arg Ile Ser Pro Pro Cys Val Gly Gly Asn Ser Leu Phe Gln 25 3 caa gtg atc tcg aaa tca cct tta tca act gag ttt cga ggt aac 377Gln Gln Val Ile Ser Lys Ser Pro Leu Ser Thr Glu Phe Arg Gly Asn 4agg tta aag gtg cag aaa aag aaa ata cct atg gga aag aac cgt gct 425Arg Leu Lys Val Gln Lys Lys Lys Ile Pro Met Gly Lys Asn Arg Ala55 6ttt tct agt tct cct cat gct gta ctt acc act gat acc tct tct gag 473Phe Ser Ser Ser Pro His Ala Val Leu Thr Thr Asp Thr Ser Ser Glu 75 8 gca gaa aag ttc agt cta gaa ggg aat att gag cta cag gtt gat 52a Glu Lys Phe Ser Leu Glu Gly Asn Ile Glu Leu Gln Val Asp 9g cct ccc act tca ggt gat gtg tcc ttt gtg gat ttt caa gct 569Val Arg Pro Pro Thr Ser Gly Asp Val Ser Phe Val Asp Phe Gln Ala aat ggt agt gat aaa ctg ttt ttg cac tgg ggg gca gta aag ttc 6sn Gly Ser Asp Lys Leu Phe Leu His Trp Gly Ala Val Lys Phe aaa gaa aca tgg tct ctt cct aat gat cgt cca gat ggg acc aaa 665Gly Lys Glu Thr Trp Ser Leu Pro Asn Asp Arg Pro Asp Gly Thr Lys gtg tac aag aac aaa gca ctt aga act cca ttt gtt aaa tct ggc tct 7yr Lys Asn Lys Ala Leu Arg Thr Pro Phe Val Lys Ser Gly Ser tcc atc ctg aga ctg gag ata cgg gac act gct atc gaa gct att 76r Ile Leu Arg Leu Glu Ile Arg Asp Thr Ala Ile Glu Ala Ile ttt ctc ata tac gat gaa gcc tac gat aaa tgg ata aag aat aat 8he Leu Ile Tyr Asp Glu Ala Tyr Asp Lys Trp Ile Lys Asn Asn ggc aat ttt cgt gtc aaa ttg tca aga aaa gag ata cga ggc cca 857Gly Gly Asn Phe Arg Val Lys Leu Ser Arg Lys Glu Ile Arg Gly Pro 22tt tca gtt cct gag gag ctt gta cag atc caa tca tat ttg agg 9al Ser Val Pro Glu Glu Leu Val Gln Ile Gln Ser Tyr Leu Arg2225 23g agg aag gga aaa cag aat tac acc cct gag aaa gag aag gag 953Trp Glu Arg Lys Gly Lys Gln Asn Tyr Thr Pro Glu Lys Glu Lys Glu 235 24a tat gag gct gct cga act gag cta cag gag gaa ata gct cgt ggt Tyr Glu Ala Ala Arg Thr Glu Leu Gln Glu Glu Ile Ala Arg Gly 256c ata cag gac att cga gca agg cta aca aaa act aat gat aaa Ser Ile Gln Asp Ile Arg Ala Arg Leu Thr Lys Thr Asn Asp Lys 265 27t caa agc aaa gaa gag cct ctt cat gta aca aag agt gaa ata cct Gln Ser Lys Glu Glu Pro Leu His Val Thr Lys Ser Glu Ile Pro 289c ctt gcc caa gca caa gct tac att agg tgg gag aaa gca gga Asp Leu Ala Gln Ala Gln Ala Tyr Ile Arg Trp Glu Lys Ala Gly295 33cg aac tat cct cca gaa aag caa att gaa gaa ctc gaa gaa gca Pro Asn Tyr Pro Pro Glu Lys Gln Ile Glu Glu Leu Glu Glu Ala 3325aga aga gaa ttg caa ctt gag ctt gag aaa ggc att acc ctt gat gag Arg Glu Leu Gln Leu Glu Leu Glu Lys Gly Ile Thr Leu Asp Glu 334g aaa aag att aca aaa ggg gag ata aaa act aag gcg gaa aag Arg Lys Lys Ile Thr Lys Gly Glu Ile Lys Thr Lys Ala Glu Lys 345 35c gtg aaa aga agc tct ttt gcc gtt gaa aga atc caa aga aag aag Val Lys Arg Ser Ser Phe Ala Val Glu Arg Ile Gln Arg Lys Lys 367c ttt ggg cag ctt att aat aag tat cct tcc agt cct gca gta Asp Phe Gly Gln Leu Ile Asn Lys Tyr Pro Ser Ser Pro Ala Val375 389a caa aag gtc ttg gaa gaa cca cca gcc tta tct aaa att aag Val Gln Lys Val Leu Glu Glu Pro Pro Ala Leu Ser Lys Ile Lys 395 4tg tat gcc aag gag aag gag gag cag att gat gat ccg atc ctt aat Tyr Ala Lys Glu Lys Glu Glu Gln Ile Asp Asp Pro Ile Leu Asn 442g atc ttt aag gtc gat gat ggg gag cta ctg gta ctg gta gca Lys Ile Phe Lys Val Asp Asp Gly Glu Leu Leu Val Leu Val Ala 425 43g tcc tct ggg aag aca aaa gta cat ata gct aca gat ctg aat cag Ser Ser Gly Lys Thr Lys Val His Ile Ala Thr Asp Leu Asn Gln 445t act ctt cac tgg gca tta tcc aaa agt cgt gga gag tgg atg Ile Thr Leu His Trp Ala Leu Ser Lys Ser Arg Gly Glu Trp Met455 467a cct tca agc ata ttg cct cct gga tca att att tta gac aag Pro Pro Ser Ser Ile Leu Pro Pro Gly Ser Ile Ile Leu Asp Lys 475 48t gcc gaa aca cct ttt tcc gcc agt tct tct gat ggt cta act tct Ala Glu Thr Pro Phe Ser Ala Ser Ser Ser Asp Gly Leu Thr Ser 49ta caa tct ttg gat ata gta att gaa gat ggc aat ttt gtg ggg Val Gln Ser Leu Asp Ile Val Ile Glu Asp Gly Asn Phe Val Gly 55ca ttt gtt ctt ttg tct ggt gaa aaa tgg att aag aac caa ggg Pro Phe Val Leu Leu Ser Gly Glu Lys Trp Ile Lys Asn Gln Gly 523t ttc tat gtt gac ttc agt gct gca tcc aaa tta gca ctc aag Asp Phe Tyr Val Asp Phe Ser Ala Ala Ser Lys Leu Ala Leu Lys535 545t ggg gat ggc agt gga act gca aag tct tta ctg gat aaa ata Ala Gly Asp Gly Ser Gly Thr Ala Lys Ser Leu Leu Asp Lys Ile 555 56a gat atg gaa agt gag gct cag aag tca ttt atg cac cgg ttt aat Asp Met Glu Ser Glu Ala Gln Lys Ser Phe Met His Arg Phe Asn 578t gct gac ttg ata gaa gat gcc act agt gct ggt gaa ctt ggt 2Ala Ala Asp Leu Ile Glu Asp Ala Thr Ser Ala Gly Glu Leu Gly 585 59t act gga att ctt gta tgg atg agg ttc atg gct aca agg caa ctg 2Thr Gly Ile Leu Val Trp Met Arg Phe Met Ala Thr Arg Gln Leu 66gg aac aaa aac tat aac gta aaa cca cgt gaa ata agc aag gct 2Trp Asn Lys Asn Tyr Asn Val Lys Pro Arg Glu Ile Ser Lys Ala6625 63c aga ctt aca gac ttg ttg cag aat gct ttc acc agt cac cct 2Asp Arg Leu Thr Asp Leu Leu Gln Asn Ala Phe Thr Ser His Pro 635 64a tac cgt gaa att ttg cgg atg att atg tca act gtt gga cgt gga 22yr Arg Glu Ile Leu Arg Met Ile Met Ser Thr Val Gly Arg Gly 656a ggg gat gta gga cag cga att agg gat gaa att ttg gtc atc 2249Gly Glu Gly Asp Val Gly Gln Arg Ile Arg Asp Glu Ile Leu Val Ile 665 67g agg aaa aat gac tgc aag ggt ggt atg atg gaa gaa tgg cat cag 2297Gln Arg Lys Asn Asp Cys Lys Gly Gly Met Met Glu Glu Trp His Gln 689g cat aat aat act agt cct gat gat gtt gtg atc tgt cag gca 2345Lys Leu His Asn Asn Thr Ser Pro Asp Asp Val Val Ile Cys Gln Ala695 77tt gac tac atc aag agt gat ttt gat ctt ggt gtt tat tgg aaa 2393Leu Ile Asp Tyr Ile Lys Ser Asp Phe Asp Leu Gly Val Tyr Trp Lys 7725acc ctg aat gag aac gga ata aca aaa gag cgt ctt ttg agt tat gac 244u Asn Glu Asn Gly Ile Thr Lys Glu Arg Leu Leu Ser Tyr Asp 734t atc cat tct gaa ccg aat ttt aga gga gat caa aag aat ggt 2489Arg Ala Ile His Ser Glu Pro Asn Phe Arg Gly Asp Gln Lys Asn Gly 745 75t ttg cgt gat tta ggt cac tat atg aga aca ttg aag gct gtt cat 2537Leu Leu Arg Asp Leu Gly His Tyr Met Arg Thr Leu Lys Ala Val His 767t gca gat ctt gag tct gct att gca aac tgc atg ggc tac aaa 2585Ser Gly Ala Asp Leu Glu Ser Ala Ile Ala Asn Cys Met Gly Tyr Lys775 789g gga gaa ggc ttt atg gtt gga gtc cag ata aat cct gta tca 2633Thr Glu Gly Glu Gly Phe Met Val Gly Val Gln Ile Asn Pro Val Ser 795 8gc ttg cca tct ggc ttt cag ggc ctc ctc cat ttt gtc tta gac cat 268u Pro Ser Gly Phe Gln Gly Leu Leu His Phe Val Leu Asp His 882a gat aaa aat gtg gaa act ctt ctt gag gga ttg cta gag gct 2729Val Glu Asp Lys Asn Val Glu Thr Leu Leu Glu Gly Leu Leu Glu Ala 825 83t gag gag ctt agg ccc ttg ctt ctc aaa cca aac aac cgt cta aag 2777Arg Glu Glu Leu Arg Pro Leu Leu Leu Lys Pro Asn Asn Arg Leu Lys 845g ctg ttt ttg gac ata gca ctt gat tct aca gtt aga aca gca 2825Asp Leu Leu Phe Leu Asp Ile Ala Leu Asp Ser Thr Val Arg Thr Ala855 867a agg gga tat gaa gaa ttg aac aac gct aat cct gag aaa atc 2873Val Glu Arg Gly Tyr Glu Glu Leu Asn Asn Ala Asn Pro Glu Lys Ile 875 88g tac ttc atc tcc ctc gtt ctt gaa aat ctc gca ctc tct gtg gac 292r Phe Ile Ser Leu Val Leu Glu Asn Leu Ala Leu Ser Val Asp 89at gaa gat ctt gtt tat tgc ttg aag gga tgg aat caa gct ctt 2969Asp Asn Glu Asp Leu Val Tyr Cys Leu Lys Gly Trp Asn Gln Ala Leu 99tg tcc aat ggt gga gac aac cat tgg gct tta ttt gca aaa gct 3Met Ser Asn Gly Gly Asp Asn His Trp Ala Leu Phe Ala Lys Ala 923t gac aga atc cgt ctt gca ctt gca agc aag gca gag tgg tac 3Leu Asp Arg Ile Arg Leu Ala Leu Ala Ser Lys Ala Glu Trp Tyr935 945c tta ttg cag cca tct gcc gaa tat cta gga tca atc ctt ggg 3His Leu Leu Gln Pro Ser Ala Glu Tyr Leu Gly Ser Ile Leu Gly 955 96g gac caa tgg gct ttg aac ata ttt act gaa gaa att ata cgt gct 3Asp Gln Trp Ala Leu Asn Ile Phe Thr Glu Glu Ile Ile Arg Ala 978a gca gct tca tta tcc tct ctt ctt aat aga ctc gat ccc gtg 32er Ala Ala Ser Leu Ser Ser Leu Leu Asn Arg Leu Asp Pro Val 985 99t cgg aaa act gca aat cta gga agt tgg cag att atc agt cca gtt 3257Leu Arg Lys Thr Ala Asn Leu Gly Ser Trp Gln Ile Ile Ser Pro Val gaa gcc gtt gga tat gtt gtc gtt gtg gat gag ttg ctt tca gtt cag 33la Val Gly Tyr Val Val Val Val Asp Glu Leu Leu Ser Val Gln2 gaa atc tac aag aag ccc acg atc tta gta gca aac tct gtt aaa 3353Asn Glu Ile Tyr Lys Lys Pro Thr Ile Leu Val Ala Asn Ser Val Lys 4ga gag gag gaa att cct gat ggt gct gtt gcc ctg ata aca cca gac 34lu Glu Glu Ile Pro Asp Gly Ala Val Ala Leu Ile Thr Pro Asp 55 cca gat gtt ctt tca cat gtt tct gtt cga gct aga aat ggg aag 3449Met Pro Asp Val Leu Ser His Val Ser Val Arg Ala Arg Asn Gly Lys 7tt tgc ttt gct aca tgc ttt gat ccc aat ata ttg gct gac ctc caa 3497Val Cys Phe Ala Thr Cys Phe Asp Pro Asn Ile Leu Ala Asp Leu Gln 85 aag gaa gga agg att ttg ctc tta aag cct aca cct tca gac ata 3545Ala Lys Glu Gly Arg Ile Leu Leu Leu Lys Pro Thr Pro Ser Asp Ile tat agt gag gtg aat gag att gag ctc caa agt tca agt aac ttg 3593Ile Tyr Ser Glu Val Asn Glu Ile Glu Leu Gln Ser Ser Ser Asn Leu 2ta gaa gct gaa act tca gca aca ctt aga ttg gtg aaa aag caa ttt 364u Ala Glu Thr Ser Ala Thr Leu Arg Leu Val Lys Lys Gln Phe 35 ggt tgt tac gca ata tca gca gat gaa ttc aca agt gaa atg gtt 3689Gly Gly Cys Tyr Ala Ile Ser Ala Asp Glu Phe Thr Ser Glu Met Val 5ga gct aaa tca cgt aat att gca tat ctg aaa gga aaa gtg cct tcc 3737Gly Ala Lys Ser Arg Asn Ile Ala Tyr Leu Lys Gly Lys Val Pro Ser 65 gtg gga att cct acg tca gta gct ctt cca ttt gga gtc ttt gag 3785Ser Val Gly Ile Pro Thr Ser Val Ala Leu Pro Phe Gly Val Phe Glu8 gta ctt tca gac gac ata aat cag gga gtg gca aaa gag ttg caa 3833Lys Val Leu Ser Asp Asp Ile Asn Gln Gly Val Ala Lys Glu Leu Gln att ctg acg aaa aaa cta tct gaa gga gac ttc agc gct ctt ggt gaa 388u Thr Lys Lys Leu Ser Glu Gly Asp Phe Ser Ala Leu Gly Glu att cgc aca acg att tta gat ctt tca gca cca gct caa ttg gtc aaa 3929Ile Arg Thr Thr Ile Leu Asp Leu Ser Ala Pro Ala Gln Leu Val Lys 3ag ctg aag gaa aag atg cag ggt tct ggc atg cct tgg cct ggt gat 3977Glu Leu Lys Glu Lys Met Gln Gly Ser Gly Met Pro Trp Pro Gly Asp 45 ggt cca aag cgg tgg gaa caa gca tgg atg gcc ata aaa aag gtg 4Gly Pro Lys Arg Trp Glu Gln Ala Trp Met Ala Ile Lys Lys Val6 gct tca aaa tgg aat gag aga gca tac ttc agc aca agg aag gtg 4Ala Ser Lys Trp Asn Glu Arg Ala Tyr Phe Ser Thr Arg Lys Val 8aa ctg gat cat gac tat ctg tgc atg gct gtc ctt gtt caa gaa ata 4Leu Asp His Asp Tyr Leu Cys Met Ala Val Leu Val Gln Glu Ile 95 aat gct gat tat gca ttt gtc att cac aca acc aac cca tct tcc 4Asn Ala Asp Tyr Ala Phe Val Ile His Thr Thr Asn Pro Ser Ser gga gac gac tca gaa ata tat gcc gag gtg gtc agg ggc ctt ggg gaa 42sp Asp Ser Glu Ile Tyr Ala Glu Val Val Arg Gly Leu Gly Glu 25 ctt gtt gga gct tac cca gga cgt gct ttg agt ttt atc tgc aag 4265Thr Leu Val Gly Ala Tyr Pro Gly Arg Ala Leu Ser Phe Ile Cys Lys4 aag gat ctc aac tct cct caa gtg tta ggt tac cca agc aaa ccg 43ys Asp Leu Asn Ser Pro Gln Val Leu Gly Tyr Pro Ser Lys Pro 6tc ggc ctt ttc ata aaa aga tct atc atc ttc cga tct gat tcc aat 436y Leu Phe Ile Lys Arg Ser Ile Ile Phe Arg Ser Asp Ser Asn 75 gaa gat ttg gaa ggt tat gcc ggt gct ggc ctc tac gac agt gta 44lu Asp Leu Glu Gly Tyr Ala Gly Ala Gly Leu Tyr Asp Ser Val 9ca atg gat gag gag gaa aaa gtt gta att gat tac tct tcc gac cca 4457Pro Met Asp Glu Glu Glu Lys Val Val Ile Asp Tyr Ser Ser Asp Pro ttg ata act gat ggt aac ttc cgc cag aca atc ctg tcc aac att gct 45le Thr Asp Gly Asn Phe Arg Gln Thr Ile Leu Ser Asn Ile Ala2 gct gga cat gct atc gag gag cta tat ggc tct cct caa gac atc 4553Arg Ala Gly His Ala Ile Glu Glu Leu Tyr Gly Ser Pro Gln Asp Ile 4ag ggt gta gtg agg gat gga aag att tat gtc gtt cag aca aga cct 46ly Val Val Arg Asp Gly Lys Ile Tyr Val Val Gln Thr Arg Pro 55 atg tgatcatatt ctcgttgtat gttgttcaga gaagaccata gatgtgatca 4657Gln Mettattctcatg gtatcagatc tgtgaccact tacctcccat gaagttgcct gtatgattat 47atcca aagccatcac atcatgttca ccttcagcta ttggaggaga agtgagaagt 4777aggaattgca atatgaggaa taataagaaa aactttgtag aagttaaatt agctgggtat 4837gatataggga gaaatgtgta aacattgtac tatatatagt atacacacgc attatgtatt 4897tgcattatgc actgaataat atcgcagcat caaagaagaa atcctttgag tggtttcaat 4957tgccgcggcc gcgaattcct gcagcccggg ggatccacta gttctagagc ggccgccacc 5tggagc tccagctttt gttcccttta gtgagggtta attt

    54PRTSolanum tuberosum 2Met Ser Asn Ser Leu Gly Asn Asn Leu Leu Tyr Gln Gly Phe Leu Thrhr Val Leu Glu His Lys Ser Arg Ile Ser Pro Pro Cys Val Gly2Gly Asn Ser Leu Phe Gln Gln Gln Val Ile Ser Lys Ser Pro Leu Ser35 4 Glu Phe Arg Gly Asn Arg Leu Lys Val Gln Lys Lys Lys Ile Pro5Met Gly Lys Asn Arg Ala Phe Ser Ser Ser Pro His Ala Val Leu Thr65 7Thr Asp Thr Ser Ser Glu Leu Ala Glu Lys Phe Ser Leu Glu Gly Asn 85 9 Glu Leu Gln Val Asp Val Arg Pro Pro Thr Ser Gly Asp Val Ser Val Asp Phe Gln Ala Thr Asn Gly Ser Asp Lys Leu Phe Leu His Gly Ala Val Lys Phe Gly Lys Glu Thr Trp Ser Leu Pro Asn Asp Pro Asp Gly Thr Lys Val Tyr Lys Asn Lys Ala Leu Arg Thr Pro Phe Val Lys Ser Gly Ser Asn Ser Ile Leu Arg Leu Glu Ile Arg Asp Ala Ile Glu Ala Ile Glu Phe Leu Ile Tyr Asp Glu Ala Tyr Asp Trp Ile Lys Asn Asn Gly Gly Asn Phe Arg Val Lys Leu Ser Arg 2lu Ile Arg Gly Pro Asp Val Ser Val Pro Glu Glu Leu Val Gln 222n Ser Tyr Leu Arg Trp Glu Arg Lys Gly Lys Gln Asn Tyr Thr225 234u Lys Glu Lys Glu Glu Tyr Glu Ala Ala Arg Thr Glu Leu Gln 245 25u Glu Ile Ala Arg Gly Ala Ser Ile Gln Asp Ile Arg Ala Arg Leu 267s Thr Asn Asp Lys Ser Gln Ser Lys Glu Glu Pro Leu His Val 275 28r Lys Ser Glu Ile Pro Asp Asp Leu Ala Gln Ala Gln Ala Tyr Ile 29rp Glu Lys Ala Gly Lys Pro Asn Tyr Pro Pro Glu Lys Gln Ile33lu Glu Leu Glu Glu Ala Arg Arg Glu Leu Gln Leu Glu Leu Glu Lys 325 33y Ile Thr Leu Asp Glu Leu Arg Lys Lys Ile Thr Lys Gly Glu Ile 345r Lys Ala Glu Lys His Val Lys Arg Ser Ser Phe Ala Val Glu 355 36g Ile Gln Arg Lys Lys Arg Asp Phe Gly Gln Leu Ile Asn Lys Tyr 378r Ser Pro Ala Val Gln Val Gln Lys Val Leu Glu Glu Pro Pro385 39eu Ser Lys Ile Lys Leu Tyr Ala Lys Glu Lys Glu Glu Gln Ile 44sp Pro Ile Leu Asn Lys Lys Ile Phe Lys Val Asp Asp Gly Glu 423u Val Leu Val Ala Lys Ser Ser Gly Lys Thr Lys Val His Ile 435 44a Thr Asp Leu Asn Gln Pro Ile Thr Leu His Trp Ala Leu Ser Lys 456g Gly Glu Trp Met Val Pro Pro Ser Ser Ile Leu Pro Pro Gly465 478e Ile Leu Asp Lys Ala Ala Glu Thr Pro Phe Ser Ala Ser Ser 485 49r Asp Gly Leu Thr Ser Lys Val Gln Ser Leu Asp Ile Val Ile Glu 55ly Asn Phe Val Gly Met Pro Phe Val Leu Leu Ser Gly Glu Lys 5525Trp Ile Lys Asn Gln Gly Ser Asp Phe Tyr Val Asp Phe Ser Ala Ala 534s Leu Ala Leu Lys Ala Ala Gly Asp Gly Ser Gly Thr Ala Lys545 556u Leu Asp Lys Ile Ala Asp Met Glu Ser Glu Ala Gln Lys Ser 565 57e Met His Arg Phe Asn Ile Ala Ala Asp Leu Ile Glu Asp Ala Thr 589a Gly Glu Leu Gly Phe Thr Gly Ile Leu Val Trp Met Arg Phe 595 6et Ala Thr Arg Gln Leu Ile Trp Asn Lys Asn Tyr Asn Val Lys Pro 662u Ile Ser Lys Ala Gln Asp Arg Leu Thr Asp Leu Leu Gln Asn625 634e Thr Ser His Pro Gln Tyr Arg Glu Ile Leu Arg Met Ile Met 645 65r Thr Val Gly Arg Gly Gly Glu Gly Asp Val Gly Gln Arg Ile Arg 667u Ile Leu Val Ile Gln Arg Lys Asn Asp Cys Lys Gly Gly Met 675 68t Glu Glu Trp His Gln Lys Leu His Asn Asn Thr Ser Pro Asp Asp 69al Ile Cys Gln Ala Leu Ile Asp Tyr Ile Lys Ser Asp Phe Asp77eu Gly Val Tyr Trp Lys Thr Leu Asn Glu Asn Gly Ile Thr Lys Glu 725 73g Leu Leu Ser Tyr Asp Arg Ala Ile His Ser Glu Pro Asn Phe Arg 745p Gln Lys Asn Gly Leu Leu Arg Asp Leu Gly His Tyr Met Arg 755 76r Leu Lys Ala Val His Ser Gly Ala Asp Leu Glu Ser Ala Ile Ala 778s Met Gly Tyr Lys Thr Glu Gly Glu Gly Phe Met Val Gly Val785 79le Asn Pro Val Ser Gly Leu Pro Ser Gly Phe Gln Gly Leu Leu 88he Val Leu Asp His Val Glu Asp Lys Asn Val Glu Thr Leu Leu 823y Leu Leu Glu Ala Arg Glu Glu Leu Arg Pro Leu Leu Leu Lys 835 84o Asn Asn Arg Leu Lys Asp Leu Leu Phe Leu Asp Ile Ala Leu Asp 856r Val Arg Thr Ala Val Glu Arg Gly Tyr Glu Glu Leu Asn Asn865 878n Pro Glu Lys Ile Met Tyr Phe Ile Ser Leu Val Leu Glu Asn 885 89u Ala Leu Ser Val Asp Asp Asn Glu Asp Leu Val Tyr Cys Leu Lys 99rp Asn Gln Ala Leu Ser Met Ser Asn Gly Gly Asp Asn His Trp 9925Ala Leu Phe Ala Lys Ala Val Leu Asp Arg Ile Arg Leu Ala Leu Ala 934s Ala Glu Trp Tyr His His Leu Leu Gln Pro Ser Ala Glu Tyr945 956y Ser Ile Leu Gly Val Asp Gln Trp Ala Leu Asn Ile Phe Thr 965 97u Glu Ile Ile Arg Ala Gly Ser Ala Ala Ser Leu Ser Ser Leu Leu 989g Leu Asp Pro Val Leu Arg Lys Thr Ala Asn Leu Gly Ser Trp 995 le Ile Ser Pro Val Glu Ala Val Gly Tyr Val Val Val Val Asp Glu Leu Leu Ser Val Gln Asn Glu Ile Tyr Lys Lys Pro Thr Ile Leu3 Ala Asn Ser Val Lys Gly Glu Glu Glu Ile Pro Asp Gly Ala Val 5la Leu Ile Thr Pro Asp Met Pro Asp Val Leu Ser His Val Ser Val 65 Ala Arg Asn Gly Lys Val Cys Phe Ala Thr Cys Phe Asp Pro Asn 8le Leu Ala Asp Leu Gln Ala Lys Glu Gly Arg Ile Leu Leu Leu Lys 95 Thr Pro Ser Asp Ile Ile Tyr Ser Glu Val Asn Glu Ile Glu Leu Ser Ser Ser Asn Leu Val Glu Ala Glu Thr Ser Ala Thr Leu Arg 3eu Val Lys Lys Gln Phe Gly Gly Cys Tyr Ala Ile Ser Ala Asp Glu 45 Thr Ser Glu Met Val Gly Ala Lys Ser Arg Asn Ile Ala Tyr Leu 6ys Gly Lys Val Pro Ser Ser Val Gly Ile Pro Thr Ser Val Ala Leu 75 Phe Gly Val Phe Glu Lys Val Leu Ser Asp Asp Ile Asn Gln Gly9 Ala Lys Glu Leu Gln Ile Leu Thr Lys Lys Leu Ser Glu Gly Asp Phe Ser Ala Leu Gly Glu Ile Arg Thr Thr Ile Leu Asp Leu Ser Ala 25 Ala Gln Leu Val Lys Glu Leu Lys Glu Lys Met Gln Gly Ser Gly 4et Pro Trp Pro Gly Asp Glu Gly Pro Lys Arg Trp Glu Gln Ala Trp 55 Ala Ile Lys Lys Val Trp Ala Ser Lys Trp Asn Glu Arg Ala Tyr7 Ser Thr Arg Lys Val Lys Leu Asp His Asp Tyr Leu Cys Met Ala 9al Leu Val Gln Glu Ile Ile Asn Ala Asp Tyr Ala Phe Val Ile His Thr Thr Asn Pro Ser Ser Gly Asp Asp Ser Glu Ile Tyr Ala Glu Val 2al Arg Gly Leu Gly Glu Thr Leu Val Gly Ala Tyr Pro Gly Arg Ala 35 Ser Phe Ile Cys Lys Lys Lys Asp Leu Asn Ser Pro Gln Val Leu5 Tyr Pro Ser Lys Pro Ile Gly Leu Phe Ile Lys Arg Ser Ile Ile 7he Arg Ser Asp Ser Asn Gly Glu Asp Leu Glu Gly Tyr Ala Gly Ala 85 Leu Tyr Asp Ser Val Pro Met Asp Glu Glu Glu Lys Val Val Ile Asp Tyr Ser Ser Asp Pro Leu Ile Thr Asp Gly Asn Phe Arg Gln Thr Ile Leu Ser Asn Ile Ala Arg Ala Gly His Ala Ile Glu Glu Leu Tyr3 Ser Pro Gln Asp Ile Glu Gly Val Val Arg Asp Gly Lys Ile Tyr 5al Val Gln Thr Arg Pro Gln Met RTArtificial SequenceDescription of Artificial Sequence Partial sequence 3Asp Lys Ala Ala Glu ThrTArtificial SequenceDescription of Artificial Sequence Partial sequence 4Ile Ala Asp Met GluTArtificial SequenceDescription of Artificial Sequence Partial sequence 5Val Trp Met Arg Phe MetTArtificial SequenceDescription of Artificial Sequence Partial sequence 6Met Gln Glu Trp His GlnTArtificial SequenceDescription of Artificial Sequence Partial sequence 7Leu Gly His Tyr MetTArtificial SequenceDescription of Artificial Sequence Partial sequence 8Glu Arg Gly Tyr Glu GluTArtificial SequenceDescription of Artificial Sequence Partial sequence 9Lys Ala Val Leu Asp ArgRTArtificial SequenceDescription of Artificial Sequence Partial sequence er Ser Leu LeuRTArtificial SequenceDescription of Artificial Sequence Partial sequence ro Asp Gly Ala ValRTArtificial SequenceDescription of Artificial Sequence Partial sequence al Cys Phe Ala ThrRTArtificial SequenceDescription of Artificial Sequence Partial sequence er Ala Asp Glu PheRTArtificial SequenceDescription of Artificial Sequence Partial sequence he Gly Val Phe GluRTArtificial SequenceDescription of Artificial Sequence Partial sequence er Gly Asp AspRTArtificial SequenceDescription of Artificial Sequence Partial sequence he Ile Cys Lys Lys



    GO   View more articles on this subject


    More Alerts from 04/11/2009


    Email This Article To A Colleague     Print A Copy Of This Page
     
     
     
     
    FLEXNEWS - Business News for the Food Industry

    About Us | Contact Us | Terms & Conditions | Privacy Policy
     
    Daily News Alerts
    Related Items
    Barley for Production of Flavor-Stable Beverage
    Barley for Production of Flavor-Stable Beverage
    Polynucleotides Encoding Phenylpropanoid Pathway Enzymes...
    Nutritionally Fortified Liquid Composition with Added...
    PUFA Polyketide Synthase Systems and Uses thereof
    Expression of Granular Starch Hydrolyzing Enzymes in...
    Docosahexaenoic Acid Producing Strains of Yarrowia...
    Beta.-glucan-containing Fat and Oil Composition and...
    Compositions Containing Sucralose and Application thereof
    Nutraceutical Compositions from Microalgae and Related...

    More in Patents
    Thioester Compounds and their Use in Fragrance or Flavor...
    Furanoid and Pyranoid C14-C18- Oxabicycloalkanones...
    Method for Preparing Calcium Gluconate
    Glycopeptide and Peptide Having a Kokumi Taste Imparting...
    Sialic Acid to Support the Immune System in the Elderly
    High-Fluidity and Non-Caking Pulverulent Crystalline...
    Extrusion Die with Extrusion Port Having a Shaped Extrusion...
    A Process for Preparing Purified Isophthalic Acid
    Method and Apparatus for Manufacturing Protein Beverages
    Bone Strengthening Food Supplement

    Top Headlines
    Procter & Gamble Repurchasing Shares, Quiet on...
    US Shoppers Going Green Despite Struggling Economy
    Wessanen Sells Liberty Richter to World Finer Foods
    Cheesecake Factory Sticks to 2010 Forecast
    European Commission Refers Greece to ECJ over Unjustified...
    JM Smucker's Quarterly Net Income Increases 172%
    Cocoa Supplier Olam to Benefit from Consolidation Among...
    Avebe and National Starch Food Innovation to Expand...
    Auchan Backs Hypermarkets as Rivals Rethink
    Ferrero Could Eye Cadbury Gum, Candy Unit
    Dole Food Posts Wider Q3 Loss
    Fonterra Sells Stake in UK Joint Venture to Arla
    Imperial Sugar Company Closes Three-Way Joint Venture...
    PepsiCo to Invest $100 Million in Egypt in 2010
    Ex-Parmalat Auditors Settle US Investor Lawsuit
    Tesco in Broadband Push as Reaches Beyond Groceries
    India Sugar Protest Forces Parliament to Shut
    Kerry Group Keeps Full Year Earnings Growth Forecast
    Nestle Professional to Acquire Vitality Foodservice
    Pinnacle Foods Acquires Birds Eye Foods for USD 1.3...
    DSM Makes Great Strides in Production Processes for...
    Russian Grocer X5 Plans Higher 2010 Capex
    Brazil: Laep in Talks to Sell Dairy Plant to Nestle
    SunOpta Announces Opening of Natural and Organic Sesame...
    Products Comprising, and Uses of, Decarboxylated Phenolic...
    Process for the Preparation of Packaged Heat-Preserved...


     


    FLEXNEWS 2009 - All rights reserved
    ISSN 1950-6228